Overleg:Harmonische rij

Uit Wikipedia, de vrije encyclopedie
Naar navigatie springen Naar zoeken springen

Inhoud

Somloze rij   ipv. divergente reeks[bewerken]

Bij dit extreem korte artikel toch een vraag. En wel over de oeroude bewerking ervan, op 2 jan 2005 door Andre Engels.
Hij liet in een korte uitleg zien dat de harmonische rij geen som heeft (niet sommeerbaar is). Niks mis mee. Maar..........waarom koos hij ervoor om dat feit te beschrijven met het zinnetje: "De bijbehorende harmonische reeks Σn ≥11/n  is divergent.".   Waarom die formulering met dat mysterieuze, nergens verklaarde, woord 'reeks'? En waarom moet erbij hoe je die (occulte) reeks kunt noteren met een sigma-vorm? Waarom niet iets gewoner, als "De bijbehorende harmonische reeks is divergent."(dan is het tenminste ook verbaal te communiceren)?   Ik kan zoiets moeilijk anders zien dan dikdoenerij, dan (opzettelijke?) wolligheid.
Wie kan argumenten noemen tegen mijn voornemen om dat zinnetje alsnog te vervangen door: "Deze rij heeft geen som."
Meer over deze vraag staat op de Overlegpagina van Reeks (wiskunde).Hesselp (overleg) 7 dec 2015 16:29 (CET)

Hesselp veinst hier dat hij niet weet wat met reeks wordt bedoeld. Binnen de wiskunde is het begrip reeks echter een gangbare term. Het lijkt me onzin als 1 gebruiker op basis van eigen onderzoek erdoor zou drukken, tegen alles in, dat een gangbare term niet meer zou 'mogen' worden gebruikt. Op een andere overlegpagina heb ik erop gewezen dat wikipedia de lezer informeert over de stand van zaken over (in dit geval: wiskundige) begrippen. Zo werkt wikipedia. Voor het publiceren van eigen onderzoek is deze encyclopedie niet bedoeld. Het wegcensureren van gangbare begrippen en daardoor de lezer niet goed informeren is m.i. in het geheel niet een constructieve bijdrage aan wikipedia. Integendeel. Groeten, Bob.v.R (overleg) 11 dec 2015 00:37 (CET)

Bij een bewerking van de inhoud[bewerken]

- In het artikel over deze speciale rij, past geen verwijzing naar het lemma Reeks. Want de inhoud daarvan blijkt sterk discutabel; het blijkt (vooralsnog?) niet mogelijk om uit te maken of het woord 'reeks' duidt op een (nergens nader beschreven) wiskundig begrip, dan wel op een (of enkele) speciale notatievorm(en) voor dat (ook 'oneindige som' genoemde) begrip. In ieder geval is de toelichting bij het niet-sommeerbaar zijn van de harmonische rij, hier beter op z'n plaats dan bij Reeks.
- De mededeling, inhoudende:
    In harmonische boventonenreeks volgt de verhouding van de snaar de principes van prime-octaaf-dubbeloctaaf, en
    volgen de onderverdeling.......de wiskundige reeks.
is dermate cryptisch dat niemand daar een lekkere taart van kan bakken.
Hesselp (overleg) 10 dec 2015 23:51 (CET)

Zie hierboven mijn reactie op pogingen het gangbare wiskundige begrip reeks weg te censureren. Bob.v.R (overleg) 11 dec 2015 00:42 (CET)
Na de reactie van Bob.v.R (11 dec 2015 00:37 en 00:42) zal ik nu ook in de artikel-tekst aangeven in welke zin de term 'reeks' door auteurs van wiskunde-teksten gebruikt wordt (ik beschreef dit al eerder op deze Overlegpagina en op die van Reeks). Wordt hiermee de door Bob.v.R bedoelde "stand van zaken" voldoende duidelijk gemaakt? En wordt de lezer nu wél "goed geïnformeerd"? Zo niet, dan graag concreet de punten noemen die nog ontbreken om van een constructieve bijdrage te kunnen spreken.
Wil Bob.v.R dat nog toegevoegd wordt dat in het huidige Reeks-artikel twee tegenstrijdige dingen gezegd worden ter beschrijving van de betekenis van het woord 'reeks'? Want de startregels zeggen daar hoe een reeks (een uitbreiding van de optelling) genoteerd wordt, terwijl verderop staat dat de term staat voor een "uitdrukking die een som voorstelt" (met 'som' zal hier bedoeld zal zijn: 'oneindige som'?).   Staat de term nu voor (ik citeer/parafraseer Bob.v.R) 'een gangbaar wiskundig begrip waarover de lezer geïnformeert dient te worden',   óf   voor een bepaalde uitdrukking (voor het niet nader toegelichte, met 'formele som' en ook met 'som' aangeduide, wiskundige begrip)?   Die artikeltekst is in dit opzicht beslist géén constructieve bijdrage aan het goed informeren van de lezer (mijns inziens; ook van anderen?).   Hesselp (overleg) 11 dec 2015 12:59 (CET)

Ik zie dat Hesselp in zijn recente edit wederom de term Harmonische reeks heeft gecensureerd, m.a.w. verwijderd. Hesselp heeft voor zover ik kan zien niet aangetoond dat dit geen gangbare term zou zijn. De situatie is nu dus: Hesselp vindt op persoonlijke gronden de term niet prettig en daarom verwijdert Hesselp deze term. Dat dit niet de bedoeling is heb ik o.a. op Overleg:Reeks (wiskunde) al betoogd. We hebben nu 1 persoon die een persoonlijke kruistocht voert tegen een gangbare wiskundige term, de lezer is de dupe. Bob.v.R (overleg) 12 dec 2015 02:11 (CET)

A. Bob.v.R laat niet blijken gezien te hebben dat ik vroeg (Overleg Rij 11 dec 12:59): "graag concreet de punten noemen die nog ontbreken om van een constructieve bijdrage te kunnen spreken". En evenmin mijn vraag of hij in het artikel Harmonische rij toegevoegd wil zien dat in het huidige Reeks-artikel twee tegenstrijdige dingen gezegd worden ter beschrijving van de betekenis van het woord 'reeks'. Graag alsnog zijn antwoorden.
B. Verder zie ik dat Bob.v.R het op 11 dec 00:42 had over "pogingen het gangbare wiskundige begrip reeks weg te censureren" en een dag later (12 dec 02:11) over het door mij censureren/verwijderen van de term 'Harmonische reeks'. Over dat laatste: in de ene artikel-versie staat die term vet gedrukt (minder gebruikelijk voor een niet-kopwoord?), in de andere cursief. Lijkt me wat anders dan 'gecensureerd/verwijderd'. In beide versies komt daarnaast de term 'reeks' nog tweemaal voor, en 'Harmonische boventoonreeks' éénmaal.
C. Met zijn 'persoonlijke kruistocht' en 'persoonlijke gronden' zal Bob.v.R doelen op mijn poging om in het Reeks-artikel expliciet aandacht te schenken aan de verschillende betekenissen (soms/vaak ook zónder aanwijsbare inhoudelijke betekenis) waarin auteurs van wiskunde-teksten het woord 'reeks' gebruiken. Dat heeft nog tot niets beters geresulteerd dan het cyclische (tegenstrijdige): een reeks wordt genoteerd als een sigma-vorm of een plussen-en-punten-vorm, en die vorm/uitdrukking/expressie is de reeks.    Ik meen dat de Wikipedia-lezer iets informatievers geboden kan worden. Hesselp (overleg) 12 dec 2015 13:03 (CET)
@Hesselp: dat ik tegen het verwijderen van gangbare terminologie (in dit geval: harmonische reeks) ben, heb ik reeds diverse malen betoogd. Als Hesselp tot in het oneindige doorgaat met detailvragen te stellen vertroebelt dit het kennelijk aanwezige verschil van inzicht over het uitgangspunt van wikipedia. Als het uiteindelijke doel van Hesselp is dat het woord 'reeks' geschrapt wordt uit wikipedia, dan merk ik hierbij voor de zoveelste maal op dat dit indruist tegen het uitgangspunt van wikipedia. Als Hesselp het uitgangspunt van wikipedia niet onderschrijft, dan merk ik (nogmaals) op dat het mogelijk is om eigen onderzoek elders te publiceren. Bob.v.R (overleg) 12 dec 2015 13:42 (CET)
Vier veronderstellingen in de zinnen van Bob.v.R die geen van alle kloppen:    1. en 3. Ik ben eveneens tegen het verwijderen uit Wikipedia van gangbare terminologie, zowel mbt. de term 'reeks', als mbt. de aanduiding(woordpaar) 'harmonische reeks'; ik zou graag concreet aangewezen zien op grond waarvan iets anders wordt verondersteld zodat ik dat nader kan weerleggen. (Het wijzen op mogelijke miscommunicatie bij het gebruiken van het woord 'reeks' is iets heel anders dan het geen aandacht willen geven aan dat woord in Wikipedia.)    2. en 4. Ik ben het ééns met ieder die vindt dat het mogelijk moet zijn om in een Wikipedia-artikel (in casu Harmonische rij) veranderingen aan te brengen. En dat van betrokkenen verwacht mag worden dat ingeval van verschillende visies, deelgenomen wordt aan overleg met een uitwisseling en weging van argumenten, onder verwijzing naar bronnen.    Mijns inziens onttrekt Bob.v.R zich hieraan, waar hij het alleen heeft over 'de hoofdzaak vertroebelende detailvragen'.
Nu inhoudelijk: Wie de versies van 'Harmonische rij' van 11 dec 12:17 en van 12 dec 13:04 naast elkaar legt ziet dat er mbt. de term 'reeks' op 12 dec naar het huidige artikel Reeks verwezen wordt, terwijl er op 11 dec een opmerking over onderaan staat (zijnde een samenvatting van wat - samen met een flink aantal bronnen - in de versie 18 nov 2015 23:35 van Reeks staat).
Er zal besloten moeten over de vraag wélke informatie over 'Harmonische reeks' voor lezers het meest relevant is. Ik nodig met name Bob.v.R nogmaals uit om te beargumenteren waarom de tekst met een verwijzing naar een tegenstrijdige uitleg bij de term 'reeks' en geheel zónder uitleg bij de (veronderstelde) inhoud van het begrip (ook zonder verwijzing naar bronnen met die uitleg), toch de voorkeur moet krijgen.
PS. Kan Bob.v.R aanwijzen waar hij op doelde met "die afwijkende definitie" (Samenvatting, in Bewerkingsgeschiedenis van Harmonische rij, 12 dec 2015 13:04)? En waar de niet-afwijkende definitie vermeld staat waarmee wordt vergeleken? Hesselp (overleg) 13 dec 2015 00:02 (CET)

Ik heb de vroegere versie (voorlopig) teruggezet. In elk geval zal de term 'harmonische reeks' genoemd moeten worden. Madyno (overleg) 13 dec 2015 12:57 (CET)

Plezierig is, Madyno, wanneer een terugzetting inhoudelijk gemotiveerd wordt. Het alleen zeggen dat "in ieder geval iets zal moeten" valt buiten die categorie. Verder kan het geen kwaad om ook de laatste zeven regels van een tekst te lezen, alvorens tot terugzetting over te gaan: dat geeft zinvol overleg een betere kans. Dit ter motivatie van het ongedaan maken van jouw terugzetting. Hesselp (overleg) 13 dec 2015 20:20 (CET)
Uit de diverse edits, zo ook hier op Harmonische rij, van Hesselp blijkt dat deze gebruiker als doel heeft het obscuur maken of geheel schrappen van de term Reeks (en Harmonische reeks).Bob.v.R (overleg) 13 dec 2015 15:00 (CET)
Graag aanwijzen in mijn laatste bijdrage aan Harmonische rij, wáár te lezen valt, of uit wélke zin of zinsdeel op te maken valt dat ik het door Bob.v.R genoemde doel zou hebben. Ik heb dat doel niet; integendeel. Hesselp (overleg) 13 dec 2015 20:20 (CET)
In sommige edits van Hesselp wordt ten onrechte beweerd dat 'rij' en 'reeks' synoniem zijn.Bob.v.R (overleg) 13 dec 2015 15:00 (CET)
Die bewering komt in de door mij geplaatste versie van Harmonische Reeks niet voor.
Op andere plaatsen wil ik dat - indien nog nodig - in de volgende zin toelichten. Mij is namelijk gebleken - uit omvangrijke literatuurstudie - dat door auteurs van wiskunde-teksten met de term 'reeks' (en 'series', etc.) nergens een ander wiskundig begrip wordt aangeduid dan: een afbeelding op de natuurlijke getallen (algemeen genoemd: 'rij', in de analyse steeds 'oneindige rij'). Definitie-pogingen als "een reeks is een met een rij geassocieerde formele [oneindige] som" (zie de huidige Reeks-versie, door Bob.v.R daarin geplaatst) zie ik niet als aanduidingen van een wiskundig begrip zolang nergens duidelijk gemaakt is wat we in het bedoelde verband onder een 'formele oneindige som' hebben te verstaan.
Je woorden "ten onrechte" hangen temeer in de lucht waar ik uit eerdere opmerkingen van jou ter zake (18 nov 2015 in Overleg Reeks) kan citeren: "....verderop bij de lezer in te wrijven dat men, als men dat wil, rij en reeks als eenzelfde begrip zou kunnen opvatten..." en "De mededeling dat op een hoger abstractieniveau een rij en een reeks identiek zijn hoort m.i. niet thuis in het begin van dit artikel.". Hesselp (overleg) 13 dec 2015 20:20 (CET)
Er is helaas sprake van een enorm verschil van inzicht over de uitgangspunten van wikipedia en over het behandelen van de term 'reeks'. Bob.v.R (overleg) 13 dec 2015 15:00 (CET)
Ik acht deze opvatting van Bob.v.R een onvoldoende excuus om telkenmale niet te willen ingaan op aan hem gestelde inhoudelijke vragen. Hesselp (overleg) 13 dec 2015 20:20 (CET)

Zolang op deze pagina geen concreet inhoudelijk overleg mogelijk blijkt over kennelijke bezwaren tegen de door mij geplaatste opmerkingen over de aanduiding 'harmonische reeks', en zolang er geen betekenisbeschrijving voor de term 'reeks' concreet getoond wordt (afwijkend van die van 'rij') lijkt het me weinig zin hebben hier nog langer te reageren op onzakelijke algemeenheden, zoals onder meer die van vandaag. Hesselp (overleg) 13 dec 2015 20:20 (CET)

Gezien de opstelling van Hesselp lijkt me dat de discussie allereerst hoort te gaan over de uitgangspunten alvorens nader in te zoomen op detailvragen. De verschillen van inzicht zijn momenteel dermate groot dat de eindeloze discussie over detailvragen m.i. weinig bijdraagt. Mijn voorstel is dat eerst, ook hier, consensus is over (1) de uitgangspunten van Wikipedia, en (2) wat deze betekenen voor de behandeling van het wiskundige begrip 'reeks'. Pas als daarover consensus is bereikt, heeft het naar mijn mening weer zin om te overleggen over de details. Groet, Bob.v.R (overleg) 13 dec 2015 21:24 (CET)
Ik stel dus nu (nogmaals) aan Hesselp voor om de detailvragen even te laten voor wat ze zijn, en eerst te bezien of er consensus over de uitgangspunten rondom de behandeling van deze onderwerpen kan worden gevonden. Mogelijk kan de discussie in Café Exact worden gevoerd. Bob.v.R (overleg) 13 dec 2015 23:57 (CET)
Verwijzing: ik zie dat een dergelijke discussie, voor wat betreft het begrip 'reeks', wordt gestart op Overleg:Reeks (wiskunde). - Bob.v.R (overleg) 14 dec 2015 23:49 (CET)

Bewerkingsoorlog[bewerken]

Gelieve overgaan tot overleg, ik heb het artikel nu voor een dag beveiligd. Sjoerd de Bruin (overleg) 15 dec 2015 13:53 (CET)

Op het verzoek van Sjoerd de Bruin tot nader overleg, het volgende.
I. Op mijn commentaar bij een verwijdering op 15 dec 12:12 ("De vraag naar, en discussie over, de eventuele betekenis van 'de bij een rij behorende formele som' is elders aan de orde") volgt een verwijdering door Madyno met als argument alleen "Hou daar mee op!"   Kan dat niet wat inhoudelijker?
II. Op 14 dec 10:58 formuleerde Madyno in OverlegReeks vier uitgangspunten voor discussie, in zes regels als volgt:
Eigen research. Het lijkt er in de discussie veel op dat eigen meningen te berde gebracht worden. Dat is niet de bedoeling en ook niet toegestaan als vermelding in een lemma. Daarom zou ik graag deze discussie wat kortsluiten door de uitgangspunten te formuleren. Eén punt is dat in ieder geval in de wiskunde - al zal niet iedere wiskundige daar zo over denken - er verschil gemaakt wordt tussen rij en reeks. En een ander punt is dat onder reeks vrij algemeen de som van oneindig veel termen verstaan wordt. Hoe dit alles gebracht wordt is een kwestie van bronnen, en niet van opvatting van gebruikers van Wikipedia. Madyno (overleg) 14 dec 2015 10:58 (CET)
III. Toegepast op de Hesselp-versie van Harmonische reeks leidt dit m.i. tot:
-a. Van in die tekst getoonde eigen mening of opvatting is m.i. nergens sprake. Wie dat anders ziet: graag concreet die punten aanwijzen.
-b. Over het verschil dat in wiskunde-teksten gemaakt wordt tussen rij en reeks, kan ik desgewenst nog wat meer expliciet toevoegen dat 'convergent' in combinatie met 'reeks' doorgaans somhebbend betekent, en in combinatie met 'rij' limiethebbend.
-c. Over de relatie tussen 'reeks' en 'de som van oneindig veel elementen' staat in de tekst een opmerking.
-d. Van 'eigen research' is m.i. geen sprake. Wie dat anders ziet: graag concreet die punten aanwijzen.
IV. Mijn bezwaar tegen de Madyno/Bob.v.R-versie.
Van de aanduiding "reeks" (2e artikelzin), noch van "de bij de oneindige harmonische rij behorende harmonische reeks" (parafrasering 2e zin), noch van "de met een oneindige rij geassocieerde formele som", noch van "de met een oneindige rij geassocieerde uitdrukking die een som voorstelt" (beide uit het gelinkte artikel Reeks), noch van "de som van oneindig veel getallen" (uit Madyno's uitgangspunten), wordt niet in het Harmonischereeks-artikel en evenmin in het Reeks(wiskunde)-artikel verteld wat de betekenis ervan is. En er wordt voor die betekenis ook niet naar bronnen verwezen.
Dat is beslist wél nodig, want zowel voor een doorsnee lezer, als voor een ervaren wiskundige is het totale adacadabra.
Op mijn inmiddels vele malen herhaalde verzoek om die uitleg, wordt alleen geroepen (sorry: gesteld): "het is algemeen bekend dat een reeks wat anders is dan een rij - dat behoeft geen nadere uitleg. En: het proberen om tóch tot zo'n uitleg te komen (c.q. te erkennen dat een inhoudelijk verschil in feite niet bestaat) is volledig in strijd met de principes van Wikipedia. (Het standpunt van Bob.v.R is mij overigens niet geheel duidelijk, maar hij ziet dit als een detailvraag die nog niet aan de orde is. Hij schreef op 18 nov. in OverlegReeks: "....dat men, als men dat wil, rij en reeks als eenzelfde begrip zou kunnen opvatten...."   en   "De mededeling dat op een hoger abstractieniveau een rij en een reeks identiek zijn hoort m.i. niet thuis in het begin van dit artikel.")  [Hesselp Hesselp (overleg) 23 dec 2015 10:45 (CET)   corrigeert een verwisseling van een tekstfragment hiervoor en hierna, onbedoeld ontstaan op 19 dec 2015 17:50 in de op 15 dec geplaatste originele tekst.]
Aan mijn opponenten de vraag: Wat blijft er na deze toelichting over aan bezwaren tegen de Hesselp-versie van Harmonische rij? En ook de vraag: welke weerlegging kan ingebracht tegen mijn ernstige bezwaar tegen het opnemen van aanduidingen als "reeks", "de met een rij geassocieerde reeks" etc. zie boven, zonder dat de lezer de weg gewezen wordt naar een inhoudelijke verklaring van die aanduidingen? 80.60.170.39 15 dec 2015 18:19 (CET)
Mijn aanmelding blijkt eerder vandaag onbedoeld te zijn weggevallen. De bovenstaande bijdrage met nummer 80.60.170.39 is door mij geplaatst. Hesselp (overleg) 15 dec 2015 21:32 (CET)
Inmiddels is op Overleg:Reeks (wiskunde) een discussie gestart over de uitgangspunten bij de behandeling van het wiskundige begrip 'reeks'. Bob.v.R (overleg) 15 dec 2015 21:39 (CET)
Ter toelichting bij Bob.v.R's "Inmiddels is op OverlegReeks een discussie gestart":
Ruim drie maand geleden, 30 aug 2015, is op OverlegReeks door Hesselp een discussie gestart onder de begin-kop "Gevraagd: een sluitende definitie van Reeks". Ondanks de inmiddels vrij forse lengte van dat 'overleg', is daar tot op de dag van vandaag maar bitter weinig inhoudelijk antwoord op gekomen. Telkens weer worden argumenten gezocht om zo'n inhoudelijk antwoord nog niet te hoeven geven. Zo ook door Bob.v.R met z'n voorwaarde dat eerst blind geaccepteerd moet worden dat wat hij in z'n hoofd heeft als "de normale definitie", in het Wikipedia-artikel hoort te staan. Hesselp (overleg) 16 dec 2015 09:43 (CET)
Hieronder een VOORSTEL, mede ter attentie van de betrokken moderator.
Er bestaan al een hele tijd aparte Wikipedia-artikelen Rij (wiskunde) en Reeks (wiskunde), en op anderstalige Wikipedia's is dat niet anders. Laat daarom dezelfde mogelijkheid open voor aparte artikelen Harmonische rij, en Harmonische reeks.
Voor het eerste vooralsnog de op 15 dec 2015 11:12 geplaatste tekst (dus ook inclusief het bewijs van de niet-sommeerbaarheid van die rij). Het tweede zal door een ander gemaakt moeten worden. (Dit mede gezien mijn huidige persoonlijke mening/opvatting/indruk - hoewel op lange studie van wiskunde-teksten terzake gebaseerd - dat in dat tweede artikel een soort nieuwe-kleren-van-de-keizer beschreven moeten worden. Maar.......misschien vergis ik me, ik blijf in spanning afwachten.) Hesselp (overleg) 16 dec 2015 09:43 (CET)
In het artikel Harmonische rij dient na de definitie van 'harmonische rij' beslist de belangrijkste eigenschap van de harmonische rij vermeld te worden. Plus het bewijs van die eigenschap van de harmonische rij . Wijziging in die zin volgt. Wanneer iemand meent dat er over een ánder wiskundig object/onderwerp interessante dingen te melden zijn, zal het voor lezers duidelijker zijn om daar dan ook een ander artikel voor te gebruiken. (Wellicht onder de kop: Harmonische reeks?)
De juistheid van de vier zinnen onder 'Ander woordgebruik' is niet bestreden of in twijfel getrokken op de Overlegpagina's Reeks en Harmonische rij; ook niet na het verzoek van Sjoerd de Bruin. Het is zinvol de lezer erop te wijzen dat in gangbaar wiskundige taalgebruik het niet-sommeerbaar zijn van de harmonische rij, op verschillende manieren wordt verwoord. Enige toelichting bij dat woordgebruik is hier niet overbodig. Hesselp (overleg) 16 dec 2015 19:38 (CET)
In de huidige versie blijft wederom geheel onbesproken naar welk (wiskundig) begrip/ding/object verwezen wordt met de aanduiding "bijbehorende reeks" (direct onder het tussenkopje). Er staat alleen welke formulevorm in aanmerking komt (aanbevolen wordt) om dat onbekend blijvende - mysterieuze - begrip visueel te verbeelden (te noteren). Te weten de in de tekst vrijstaande sigma-vorm; maar een vorm kan niet divergent of convergent zijn, noch een som hebben. Een rij kan dat soort eigenschappen wél hebben, maar met dat "bijbehorende reeks" wordt waarschijnlijk geen rij bedoeld. Wat wél?
De artikelversie van 17 dec 6:04 beschrijft wél wat in gangbaar wiskundig taalgebruik bedoeld wordt op plaatsen waar 'reeks' en 'harmonische reeks' voorkomt. Om die reden is die versie meer informatief, en wordt die versie teruggeplaatst.
Madyno geeft aan (in z'n samenvatting bij Geschiedenis) dat de sectie "Ander woordgebruik" niet thuishoort in dit artikel.   Kan hij aangeven waarom hij meent dat het vermelden van een drietal gangbare parallelle formuleringen van de besproken en bewezen eigenschap van de harmonische rij, hier niet thuis zou horen? En waarom ook de verklarende toelichting bij dat (enigszins onregelmatige) woordgebruik hier niet thuis zou horen? Hesselp (overleg) 19 dec 2015 00:25 (CET)

Op 11 dec 2015 om 00:01 uur was door Hesselp een stuk tekst over de harmonische reeks toegevoegd. Ik heb geen probleem met deze toevoeging, mits dat stuk tekst dan ook het juiste kopje 'harmonische reeks' heeft. Mocht Hesselp inmiddels niet meer als doel hebben om de lezer te onthouden van informatie over het begrip en de gebruikelijke term 'reeks', dan neem ik aan dat hij geen bezwaar meer heeft tegen het hanteren van het correcte kopje boven dat stuk tekst. De consequentie is dan vooralsnog dat er in het artikel meer wordt gemeld over de bij de rij behorende reeks dan over de rij zelf, maar misschien komen er in de toekomst nog toevoegingen over de rij, zodat e.e.a. meer in balans is. Bob.v.R (overleg) 19 dec 2015 02:55 (CET)

Bob.v.R heeft het hierboven in elk van z'n vier zinnen over 'harmonische reeks'/'het begrip reeks'/'bij de rij behorende reeks'. Zodoende blijft de precieze boodschap van elk van die zinnen - alweer - in de lucht hangen. En wel omdat een eventuele wiskundige inhoud van die aanduidingen, nog steeds door niemand ergens beschreven blijkt te zijn. Ook niet in het Wikipedia-artikel Reeks.
Wel kan worden opgemerkt dat het woordpaar 'harmonische reeks' in gangbaar wiskundig taalgebruik voorkomt in samengestelde formuleringen (met divergent / niet convergent / geen som hebbend, e.d.); over de betekenis van sommige van die samengestelde formuleringen bestaat - tegenwoordig - algemene overeenstemming, niet over allemaal. Vermelding hiervan in het artikel is voor een lezer zeker informatief.
Het woord 'reeks' is (voor zover mij bekend) geen term met een, van die van 'rij' afwijkende, wiskundige inhoud . Het wordt in gangbaar taalgebruik wel als sfeer-aanduidende term gebruikt (zie onder 'Ander woordgebruik'). Als dat onderscheid in wiskunde-teksten genegeerd wordt, maakt dat die teksten erg lastig leesbaar (zeker voor niet-volledig ingewijden, en voor die groep zijn ze in de regel bedoeld, ook dit artikel 'Harmonische rij') .
Ten slotte. In het artikel 'Harmonische rij' hoort de vermelding van, en het bewijs van, de belangrijkste eigenschap van de harmonische rij, direct onder de kop 'Harmonische rij'. En niet onder een subkop die verwijst (in het eerste halve regeltje onder die kop) naar iets niet-bestaands waarvan gesteld wordt dat het zou 'behoren bij de harmonische rij'. Hoe kan Bob.v.R motiveren dat (zie zijn tweede en derde zin hierboven) het tussenkopje 'Harmonische reeks' dat bedoelt te verwijzen naar een niet bestaand begrip (want niet naar 'rij') toch het "juiste kopje"/"het correcte kopje" zou zijn? Hesselp (overleg) 19 dec 2015 14:53 (CET)
Het "andere woordgebruik" betreft in het algemeen de termen 'rij' en 'reeks' en slaat niet speciaal op harmonische rijen en reeksen. Vandaar dat ik van mening ben dat vermelden in dit lemma niet op z'n plaats is. Madyno (overleg) 19 dec 2015 12:42 (CET)
Madyno, met je eerste zin kan ik meegaan. Verder: wanneer een beschouwing als in "Ander woordgebruik" over 'rij' en 'reeks' is opgenomen in het lemma Reeks, zal hier in "Harmonische rij" volstaan kunnen met een korte verwijzing. Tot dan toe blijft deze informatie op deze plaats relevant.
Beter ergens dan nergens. (Tenzij natuurlijk iemand er onjuistheden in aanwijst.)Hesselp (overleg) 19 dec 2015 14:53 (CET)
Hesselp blijft op het standpunt staan dat hij of "niet weet" wat een reeks is, of het een synoniem vindt van 'rij'. Ik vind dat geen constructieve bijdrage aan het overleg, omdat het aan de kant van Hesselp gaat om veinzen iets niet te weten. Ik stel voor dat dit geveins van Hesselp wordt voortgezet op Reeks, dan houden we discussie over de uitgangspunten in ieder geval centraal. Veinzen iets niet te weten kan echter geen rechtvaardiging zijn voor censureren van een gangbare (zoals ook Hesselp bekend is) wiskundige term. Bob.v.R (overleg) 19 dec 2015 16:14 (CET)
De suggestie dat ik iets zou 'veinzen' raakt kant noch wal. Het is niet anders dan een uitvlucht van Bob.v.R om niet gewoon hardop te hoeven zeggen dat hij zelf die schimmige 'betekenis' van reeks (anders dan rij) evenmin kent als ieder ander. Want waarom anders heeft hij na een maand steggelen nog nóóit een poging gedaan om zijn ideeën daaromtrent op een overlegpagina te zetten? Nee sorry, dat zeg ik fout, want hij heeft zich er eerder wél over uitgelaten. Hij schreef op 18 nov. in OverlegReeks: "....dat men, als men dat wil, rij en reeks als eenzelfde begrip zou kunnen opvatten...."   en   "De mededeling dat op een hoger abstractieniveau een rij en een reeks identiek zijn hoort m.i. niet thuis in het begin van dit artikel."
We wachten dus nog steeds alleen op zijn ideeën over wat er op een lager abstactieniveau, thuishorend in het begin van een artikel, voor verschillen aan te wijzen zijn. Graag op déze Overlegpagina, want híér horen de motivaties thuis voor het wegschuiven van artikel-versies van 'Harmonische rij'.
Het verschil tussen een harmonische reeks en een harmonische rij, is in ieder geval NIET af te leiden uit de bewijzen voor het geen som hebben (ook genoemd 'divergent zijn') van de harmonische reeks, en voor het geen som hebben van de harmonische rij. Want die bewijzen zijn tot op de laatste komma identiek. Zo zijn ook álle andere eigenschappen die aan een reeks en een rij worden toegekent, volledig identiek. Het enige verschil zit 'm in de náámgeving in één situatie: het is helaas gewoonte geworden om als je het ding (de afbeelding op de natuurlijke getallen) 'rij' noemt, dat dan 'convergent' (en 'divergent') tegenwoordig een andere betekenis aangeeft dan wanneer je datzelfde ding 'reeks' noemt. Andere verschillen zijn er NIET (nou ja, dat is mijn ervaring, kom maar op met andere verschillen!). Hesselp (overleg) 19 dec 2015 18:50 (CET)
Graag uitleg van de sympathisanten van de huidige tekstversie, bij de logica van:
De harmonische reeks is divergent (= heeft geen som), wat inhoudt (= wat betekent = waaruit volgt) dat de harmonische rij geen som heeft (aangezien de subtotalen van de harmonische rij geen grens kennen).
Waar is dat "wat inhoudt" op gebaseerd? Hesselp (overleg) 19 dec 2015 22:06 (CET)
Mijn opmerkingen van 18 november 2015 hadden betrekking op artikelteksten van Hesselp, die op dat moment nog van mij het voordeel van de twijfel kreeg betreffende de inhoud van zijn teksten. Dat voordeel van de twijfel heeft Hesselp inmiddels wel verspeeld, ik neem iedere opmerking terug die iemand (ten onrechte) zo zou kunnen interpreteren dat ik zou hebben verkondigd dat rij en reeks synoniem zijn. Ten tweede het volgende: dat ik gebruik maak van een 'uitvlucht' laat ik voor rekening van Hesselp, ik herken mij absoluut niet in die interpretatie. Ik stel vast dat Hesselp bij herhaling suggereert dat hij 'niet weet' wat een reeks is. Ik kan dat niet serieus nemen en ik stel mij op het standpunt dat Hesselp wel degelijk bekend is met het begrip 'reeks', hetgeen impliceert dat hij hier iets veinst. Over de in wikipedia gebruikte definitie van het begrip 'reeks' is in beginsel constructief overleg mogelijk, maar met Hesselp die immers als ultieme doel heeft om dit begrip te schrappen uit wikipedia, zie ik dat constructieve overleg voorlopig niet plaatsvinden. Vandaar mijn eerdere vaststelling dat er eerst consensus nodig is over de uitgangspunten van wikipedia en de uitgangspunten bij de behandeling, in wikipedia, van het wiskundige begrip 'reeks'. Bob.v.R (overleg) 20 dec 2015 02:14 (CET)
Ik sluit me hier volledig bij aan. Madyno (overleg) 20 dec 2015 10:40 (CET)

Vredesvoorstel[bewerken]

De beveiliging kan af van Harmonische rij, als er overeenstemming is. Ik doe een poging:
In de huidige versie van Harmonische rij staat onder de sigma-vorm de in deze context uit de lucht vallende implicatie: "De harmonische reeks is divergent, en dus heeft de harmonische rij geen som, etc."
Vraag. Wie heeft er bezwaar tegen dat ik na de kerstdagen de blokkerende moderator laat weten dat er overeenstemming is over onderstaande vervanging? Te weten:

Het huidige
"Deze reeks is divergent, wat inhoudt dat de harmonische rij niet sommeerbaar is, geen (eindige) som heeft, aangezien de partieelsommen van deze rij doorgroeien naar oneindig. Dat laatste volgt uit de vergelijking van ..."
vervangen door:
Tussenkopje "Niet sommeerbaar", en dan: "De harmonische reeks heeft geen som, de harmonische rij evenmin. Zowel het één als het ander volgt uit de vergelijking van ..."

Bij detailbezwaren graag een alternatief voorstel, ter vermijding van de (op die plaats nog niet waargemaakte) implicatie.   Mocht deblokkering volgen, dan zal ik toch (in ieder geval tot 20 maart) van die vernieuwde versie afblijven.
Reacties graag hieronder. Hesselp (overleg) 21 dec 2015 22:06 (CET)

De zin De harmonische reeks heeft geen som, de harmonische rij evenmin. lijkt mij verwarrend, in die formulering kan ik mij niet geheel vinden. Maar los daarvan lijkt het mij beter eerst om te zoeken naar consensus over de uitgangspunten, zie Overleg:Reeks (wiskunde). Zolang die consensus niet bereikt is, verwacht ik dat de onderlinge conflicten zullen blijven optreden. Bob.v.R (overleg) 21 dec 2015 23:04 (CET)
De door Bob.v.R gesignaleerde kans op verwarring, lijkt me te ondervangen (wie heeft wat beters?) door het eerdere voorstel als volgt te verduidelijken:
Tussenkopje "Niet sommeerbaar", en dan: "De harmonische reeks   Σn =1,2,···(1/n)   heeft geen som, de harmonische rij   (1/n)n =1,2,···   evenmin. Zowel het één als het ander volgt uit de vergelijking van ..." . Hesselp (overleg) 22 dec 2015 16:37 (CET)
"...conflicten zullen blijven optreden." ??? Wie kan er in de toekomst zien.
Mijn vraag betreft de huidige tekst van Harmonische rij. Heb jij een gladder/beter/logischer voorstel om de gesignaleerde hobbel uit die éne zin te halen?
Waarom lijk je nog niet voldoende tevreden, nu ik, mijns inziens duidelijk, laat blijken de huidige opzet van deze mini-pagina te accepteren? Ik zie niet dat je bestrijdt dat die hobbel er zit: kom daarom met een betere versie. Los van je - sombere - verwachting. Hesselp (overleg) 21 dec 2015 23:55 (CET)
Het overleg over de uitgangspunten zit op dit moment muurvast, maar toch heeft dat wat mij betreft nu de prioriteit. Als de opinies over de uitgangspunten zo sterk uit elkaar liggen als nu, dan zullen we over dit artikel ook geen consensus bereiken. Bob.v.R (overleg) 22 dec 2015 00:49 (CET)

Ik wil wel eens weten waarom die tekst vervangen zou moeten worden. Madyno (overleg) 22 dec 2015 10:42 (CET)

Antwoord aan Madyno: zie de tweede zin onder het kopje 'Vredesvoorstel' hierboven.   Achter 'aangezien' volgt in het huidige artikel een bewijs voor het geen som hebben van de harmonische rij. Dan is het niet voor iedereen duidelijk waarom eerder in dezelfde zin gesteld wordt dat het niet sommeerbaar zijn van diezelfde harmonische rij ook al volgt uit ('wat inhoudt dat....') het divergent zijn (synoniem voor geen som hebben) van de harmonische reeks. (Als het 'wat inhoudt dat...' voor iedereen duidelijk zou zijn, zijn de tien regels eronder overbodig.)
Overigens, bij het voorstel om die ene zin te vervangen, is er totaal geen sprake van 'moeten'. Het betreft een zoeken naar een alternatief, ter vermijding van de (op die plaats - voorzover ik zien kan - nog niet waargemaakte) implicatie. Hesselp (overleg) 22 dec 2015 14:05 (CET)

Ik zie nergens dat het een een gevolg is van het ander. Madyno (overleg) 23 dec 2015 00:06 (CET)

Madyno, je wekt de indruk dat je de woorden "wat inhoudt dat..." in de huidige artikeltekst, anders interpreteert dan als "dit betekent dat...", "dit heeft tot gevolg dat...", "hieruit volgt dat...", "dus...". Kun je aangeven hoe naar jouw idee de woorden "wat inhoudt dat..." ook anders te lezen zijn? Hesselp (overleg) 23 dec 2015 10:45 (CET)

Synoniem voor 'wat betekent', Madyno (overleg) 23 dec 2015 12:26 (CET)

Madyno, dank voor je reactie. Ook al is het nog steeds zo, dat met jouw synoniem het begindeel van de artikelzin "De harmonische reeks is divergent, wat betekent dat de harmonische rij niet sommeerbaar is, ..." de vorm zou hebben van een implicatie.   Wat er door de schrijver mee bedoeld is, hangt in de lucht. En wel omdat het waar zijn van het antecedent 'De harmonische reeks is divergent' nog niet als aangetoond wordt beschouwd.
Graag een vervanging van de huidige zin (door jou op 17 december ingevoegd) door een formulering waaruit de bedoelde betekenis - zonder de suggestie van een implicatie - ook door anderen af te lezen is.
Ter zijde. Ik ga ervan uit dat je het me eens bent dat in het (schrijf)taalgebruik van wiskundigen de formuleringen "De harmonische reeks is divergent",   "De harmonische reeks is niet sommeerbaar",   "De harmonische reeks heeft geen som",   "De harmonische reeks   Σn =1,2,···(1/n)   is divergent",   "De harmonische reeks   Σn =1,2,···(1/n)   is niet sommeerbaar"   en   "De harmonische reeks   Σn =1,2,···(1/n)   heeft geen som",   hetzelfde betekenen (synoniem zijn). Hesselp (overleg) 23 dec 2015 15:18 (CET)
'A betekent B' is synoniem met/betekent hetzelfde als/is equivalent aan de equivalentie A ≡ B. Dat is heel wat anders dan 'uit A volgt B', 'A heeft B als gevolg' of 'A, dus B' wat equivalent is aan de implicatie A → B. Mvg, Trewal 28 dec 2015 00:45 (CET)
Dag Trewal, een nieuwe naam op deze pagina. Welkom, en vooral ook omdat je ingaat op de feitelijke kern van mijn probleem met die ene zin in de huidige versie van Harmonische rij (direct onder de sigma-vorm). Ik voelde direct de neiging om opmerkingen te gaan maken bij al dan niet aantoonbare betekenisverschillen tussen   'A betekent B',   'A betekent dat B',   'A, wat betekent B',   'A, wat inhoudt dat B',   'A betekent hetzelfde als B'   en nog wel méér. Het lijkt me echter veel efficiënter om eerst aan jou het volgende te vragen. Namelijk, wat lijkt jou de duidelijkste manier om onder woorden te brengen wat de schrijver van de huidige zin bedoeld zal hebben. Of als je daar twijfels over hebt, welke zin past op deze plaats het best in het artikel. Zelf struikel ik over het "wat inhoudt dat" en ook over het "aangezien" (wijst dat terug naar A, naar B, naar beide?).
Lijkt het daarbij niet handig om de huidige zin, met wat extra 'franje', te reduceren tot: "De H-reeks heeft geen som, wat inhoudt dat de H-rij geen som heeft, aangezien de partieelsommen van deze rij doorgroeien naar oneindig." (Of heb ik nu al wat essentieels veranderd?)  Groetend, Hesselp (overleg) 28 dec 2015 01:46 (CET)
Nee, dat lijkt me niet handig. "De H-reeks heeft geen som" is betekenisloos. De reeks is namelijk gedefinieerd als een som. Die reeks convergeert (≡ de rij heeft een eindige som) of divergeert (≡ de rij heeft geen eindige som). De huidige zin heeft de volgende uitspraken: "Deze reeks is divergent" (A), "de harmonische rij is niet sommeerbaar" (B), "de harmonische rij heeft geen (eindige) som" (C) en "de partieelsommen van deze rij groeien door naar oneindig" (D). Die uitspraken worden door de zin als volgt gekoppeld: D → (A ≡ B ≡ C). Dat is correct en hoeft dan ook niet "verbeterd" te worden, zeker niet met extra 'franje' die niet correct is. Mvg, Trewal 28 dec 2015 10:42 (CET)
Bedankt Trewal voor weer een bijdrage aan de oplossing van de puzzel. Ik heb twee opmerkingen in de marge van de hoofdzaak, en als derde meer een kernvraag. (Mogelijk heb ik daarna nog iets, maar ik wil eerst je al dan niet instemming op 1, 2 en 3 afwachten.)
1. Over synoniem en equivalent (jouw regels 28 dec 00:45). Zijn we het erover eens dat 'synoniem' een woord uit de taalkunde is: twee woorden (of twee uit meer woorden bestaande verbale aanduidingen) noemen we synoniem als ze dezelfde inhoud hebben / hetzelfde ding/begrip aanduiden. Daarnaast geven we met 'equivalent' (hier in de logica/wiskunde) aan dat twee beweringen tegelijk waar of tegelijk onwaar zijn. (Uit het één volgt het ander en tegelijk óók: uit het ander volgt het één; een tweezijdige implicatie dus). Lijkt me nuttig om uit elkaar te houden.
2. Is "de som van een reeks" betekenisloos?   Vaak (ja hééél vaak) wordt 'som' gebruikt in een betekenis-beschrijving van 'reeks', okee. Maar daarnaast spreek ik toch in de ogen van velen geen wartaal als ik zeg dat het getal 2 de som is van de bij de rij 1, 1/2, 1/4, 1/8,··· behorende reeks'? Die dubbele gebruiksbetekenis van hetzelfde woordje 'som' zorgt voor veel ongemak en overlast, helaas.   Dit gezegd hebbend, wil ik wel proberen om ter vermijding van onnodig misverstand, hier steeds te kiezen voor "de reeks is convergent" en niet voor wat ik voel als synonieme aanduidingen "de reeks is sommeerbaar" of "de reeks heeft een som". (Je kon best eens gelijk hebben als je zegt dat de eerste verwoording veel gebruikelijker is dan de tweede en de derde.)
3. Met mijn woord 'franje' bedoelde ik dat "de H-rij is niet sommeerbaar" en "de H-rij heeft geen (eindige) som" zeer dicht bijelkaar liggende verwoordingen zijn voor dezelfde bewering. Ter versimpeling koos ik voor de mengvorm "de H-rij heeft geen som".
Nu de pijl-formule in je laatste zin. Met weglating van variant C, lees ik dit in woorden als: uit het waar zijn van bewering/uitspraak D volgt dat de beweringen A en B gelijkwaardig zijn. (Dus: allebei waar of allebei onwaar.)   Ik vermoed dat het niet zo bedoeld is, en dat je wél bedoelde: bewering D impliceert zowel A als B. In formulevorm (als ik me goed herinner): D → (A & B). Of zit het toch nog anders? Ik ben benieuwd. Hesselp (overleg) 28 dec 2015 19:15 (CET)
Zo moeilijk is het toch niet: A, B en C zijn equivalent, en D impliceert alle drie. Ter afsluiting: er is niets mis met de huidige zin. Ik ga er dan ook verder geen tijd aan besteden om daar nog lange verhandelingen over te lezen/schrijven. Want wat niet fout is, hoeft niet "verbeterd" te worden. Mvg, Trewal 28 dec 2015 19:32 (CET)
Je gebruikte dus wel de verkeerde notatie: D → (A ≡ B ≡ C) betekent dat D de equivalentie van A, B en C impliceert. Dat is heel wat anders. - Patrick (overleg) 28 dec 2015 22:38 (CET).
Ook heel kort. In   "D impliceert A, B en C"   invullen van D, A en B (weglaten van C verandert de essentie niet) geeft: Aangezien de partieelsommen van deze rij doorgroeien naar oneindig, is de harmonische reeks divergent en is de harmonische rij niet sommeerbaar. Dat laatste volgt uit de vergelijking van ....etc.
Volgens Trewal is dit de uitleg bij een passage in Harmonische reeks; een passage die geen verbetering behoeft.   Of is een en ander toch anders bedoeld? Hoe dan wel? Hesselp (overleg) 28 dec 2015 20:02 (CET)
Nee, dat is volgens mij niet de uitleg, maar jouw invulling, waarin je een andere volgorde aanhoudt dan de zin die nu in het artikel staat, waardoor de vervolgzin "Dat laatste..." niet meer klopt. Ik heb het gevoel dat je dat zelf ook wel in de gaten hebt en dat je maar wat loopt te dollen. Daar leen ik me niet voor. Gegroet, Trewal 28 dec 2015 21:26 (CET)
Volgende poging om de artikelzin te laten aansluiten bij de D-A-B(-C)-formule van Trewal:
De harmonische reeks is divergent en de harmonische rij is niet sommeerbaar; beide omdat de partieelsommen van de harmonische rij doorgroeien naar oneindig.   Dat laatste volgt uit...
Is dit nu een correcte weergave van wat de huidige artikelzin wil overbrengen? En zijn Madyno en Bob.v.R het hiermee eens? Hesselp (overleg) 28 dec 2015 22:17 (CET)
Ik zie dat in het Reeks-artikel op verschillende plaatsen sprake is van 'de som van de/een reeks'. Een correcte weergave van de zin in Harmonische rij zou dus ook zijn (nu mét de C-variant):
De harmonische reeks is divergent (heeft geen som) en de harmonische rij is niet sommeerbaar (heeft geen som); beide omdat de partieelsommen van de harmonische rij doorgroeien naar oneindig.   Dat laatste volgt uit... Hesselp (overleg) 28 dec 2015 22:39 (CET)

"Inhouden": implicatie of equivalentie?[bewerken]

Van het werkwoord "inhouden" is niet altijd zo duidelijk of implicatie of equivalentie wordt bedoeld. Het kan daarom misschien beter vermeden worden. - Patrick (overleg) 28 dec 2015 22:47 (CET)

Zelfs het woord "betekenen", dat op het eerste gezicht doelt op equivalentie per definitie, wordt soms gebruikt in de betekenis van implicatie ("Het is oudejaarsavond. Dat betekent dat er geen treinen rijden."), dus daarmee is het ook oppassen. - Patrick (overleg) 28 dec 2015 22:51 (CET)

Patrick, ik ben het deze keer volledig met je eens; ook met je opmerking van 28 dec 2015 22:38. Zou je kunnen kijken of je nog verbeteringen kunt vinden in mijn parafraseringen van de bediscussieerde zin uit het artikel Harmonische reeks (28 dec 2015 22:17 en 28 dec 2015 22:39)? Hesselp (overleg) 29 dec 2015 00:44 (CET)

"De som van de reeks is oneindig" is niet goed verenigbaar met "de reeks heeft geen som" of met "de reeks is niet sommeerbaar"[bewerken]

Het lijkt me dan beter te zeggen "de reeks heeft geen eindige som" of "de reeks heeft geen som in " of al naar gelang de verzameling: "de reeks heeft geen som in ". - Patrick (overleg) 29 dec 2015 21:59 (CET)

Patrick, wat bedoel je met "niet goed verenigbaar"? In de standaard-wiskunde is het toch altijd óf wit, óf zwart?   Kun je opschrijven welke verwoording van de betreffende zin in het artikel Harmonische rij jij het beste vindt? Hesselp (overleg) 29 dec 2015 22:30 (CET)
Ik bedoel dat (in het algemeen bij reeksen) "de reeks heeft geen som" onduidelijk is, omdat niet duidelijk is of een som oneindig telt als som. - Patrick (overleg) 29 dec 2015 23:42 (CET)
Dit geldt trouwens algemener voor limieten, ik heb Limiet#Oneindig als 'limiet' aangepast. - Patrick (overleg) 30 dec 2015 08:45 (CET)
Patrick, ik wacht nog op jouw voorkeursversie voor de zin beginnend met 'Deze reeks is...'   in Harmonische rij; gezien de op(aan?)merkingen die je erbij maakte.
Van mijn kant nog twee dingen: (1) Het "heeft geen som" is op deze plaats maar op één manier te lezen, vanwege het "aangezien...." er pal achter; vind je niet?   (2) Dit met name aan Trewal die op 28 dec 10:42 schreef dat 'de som van een reeks' betekenisloos is. Zie [1] met het door Bob.v.R toegevoegde: "Een convergente reeks is een reeks met een limiet. Deze limiet wordt de 'som' van de reeks genoemd."   Hesselp (overleg) 31 dec 2015 11:46 (CET)
Als je som niet leest als het proces van sommatie, maar ook als het resultaat ervan, dan kun je inderdaad spreken van "de som van de som", waarbij som de eerste keer het resultaat en de tweede keer de bewerking zelf voorstelt. In dat geval kun je ook spreken van "de som van de reeks".
Voor hier verdergegaan wordt met het verzinnen van allerlei alternatieven voor de in het huidige artikel gebruikte formulering, lijkt het me verstandig om eerst te bepalen of er überhaupt wel iets fout is in die huidige formulering. Zolang dat niet vaststaat, heeft het zoeken naar alternatieven weinig zin, wegens WP:BTNI. "Het lijkt me beter" is namelijk an sich geen argument om iets aan te passen. Mvg, Trewal 31 dec 2015 15:00 (CET)
Ook als iets niet onomstreden fout is, kan er m.i. toch wel eens sprake zijn van een beter/duidelijker alternatief. Uit de discussie tot dusver is me nog niet gebleken dat de zin   "De harmonische reeks is divergent (heeft geen som) en de harmonische rij is niet sommeerbaar (heeft geen som); beide omdat de partieelsommen van de harmonische rij doorgroeien naar oneindig."   iets anders zegt dan wat met de huidige artikelzin bedoeld was/is.
Los hiervan. Trewal kent aan bewering A (de harmonische reeks is divergent) en bewering B (de harmonische rij is niet sommeerbaar) een overeenkomende - in volgorde verwisselbare - rol toe in de zin als geheel. Dat lijkt me inderdaad ook de bedoeling van de schrijver.   In deze situatie heb ik echter moeite met het "deze rij" aan het eind van de zin: waar verwijst het 'deze' naar? Gesuggereerd wordt mijns inziens zowel naar A als naar B. Wie ziet dit anders.......of 'loop ik nu weer maar wat te dollen'?   Hesselp (overleg) 31 dec 2015 17:37 (CET)
In de door jou genoemde A en B komt maar eenmaal het woord 'rij' voor, dus dat is waar deze in 'deze rij' op slaat. Als je het niet op A en B betrekt maar op de huidige zin in het artikel ("Deze reeks is divergent, wat inhoudt dat de harmonische rij niet sommeerbaar is, geen (eindige) som heeft, aangezien de partieelsommen van deze rij doorgroeien naar oneindig."), dan is ook duidelijk dat deze in 'deze rij' slaat op 'de harmonische rij' in die zin. Want ook in die zin komt (behalve de verwijzing 'deze rij' zelf) maar eenmaal het woord 'rij' voor. Het lijkt er dus inderdaad weer op dat je maar wat loopt te dollen... Mvg, Trewal 31 dec 2015 18:53 (CET)
Beste Trewal, dacht je nu echt dat ik dit antwoord van je niet voorzien had? Dus wél.
We dollen dus nog even door. Nog iets ingekort, beweer jij dat de zin "Reeks A heeft een som en rij B heeft een som, aangezien de partieelsommen van deze rij...."   logisch correct is.
Maar........als je de aangezien-implicatie niet in de inverse vorm schrijft (terwille van het 'Dit laatste' in de vervolgzin) maar in de directe volgorde (jouw D → (A = B)   of mijn m.i. correcte   D → (A & B) ), dan hangt het 'deze rij' volledig in de lucht.
Het omgekeerd uitspreken/opschrijven van de implicatie mag dit schijnbaar verhullen, maar de fout blijft. Het antecedent kan géén verwijzing bevatten naar iets in het consequent. Of zie jij dat anders: dan ligt dáár ons discussiepunt.
PS Waar haal jij dat equivalentie-teken vandaan? PS2. Alvast veel sterkte gewenst in het nieuwe jaar met alle dollende lastposten die op je scherm verschijnen.  Groetend, Hesselp (overleg) 31 dec 2015 20:41 (CET)
Je dolt inderdaad nog even door: als je het eerste deel van de zin anders schrijft, dan klopt de verwijzing in het tweede deel niet meer. Dan dol ik nog even terug: dat klopt, daarom moet je het eerste deel van de zin gewoon zo laten staan, want dan klopt de verwijzing in het tweede deel wel. Duh! PS. Gebruik copy/paste om het symbool voor equivalentie te kopiëren uit een andere tekst. PS2. Alvast veel plezier gewenst met het verder dollen! Mvg, Trewal 31 dec 2015 21:33 (CET)
Twee reacties, aan Trewal:
I.  Op 28 dec 22:38 noemde je als jouw interpretatie van 'de huidige zin':  "D impliceert alle drie" (te weten: A, B en C).
a. Mee eens dat dat ook betekent: "D impliceert A en B" ?
b. Ook: "D → (A&B)" ?
c. Ook: (A&B)← D" ?
d. Ook: "De H-reeks is divergent en de H-rij is niet sommeerbaar, aangezien D" ?
e. Ook: "De H-reeks heeft geen som en de H-rij evenmin, aangezien de partieelsommen van deze rij doorgroeien naar oneindig" ?    Waar is dat 'anders schrijven' van mij ontspoort?
II. In alle genoemde varianten staat overigens de logische fout dat in het antecedent van de implicatie, verwezen wordt naar iets in het consequent.
Jij noemt dit 'dollen', en schrijft aan 'Bob' dat je weinig zin hebt nog langer te bestrijden dat er een logische fout zou zitten in die "Deze reeks is divergent...."-zin. Okee. Dan blijft het fout noemen van die zin dus niet langer aangevochten.  En evenmin dat er reden is te stellen dat het op 22 dec 16:37 voorgestelde alternatief, béter is.
[Tussenkopje "Niet sommeerbaar", en dan:  "De harmonische reeks Σn =1,2,···(1/n) heeft geen som, de harmonische rij
(1/n)n =1,2,··· evenmin. Zowel het één als het ander volgt uit de vergelijking van ..."] Hesselp (overleg) 1 jan 2016 16:18 (CET)
  • Als het niet langer reageren op "dollen" gelijkgesteld wordt met het toegeven dat er een fout in de huidige zin staat (dat is de logische conclusie die je trekt) dan zou de inhoud van Wikipedia-artikelen uiteindelijk bepaald worden door degene met de langste adem, ongeacht wat zij verkondigen. Gelukkig is dat niet het geval.
  • Het met "deze rij" verwijzen naar een ander deel van de zin is een taalkundige verwijzing, en is heel wat anders dan de logische fout om in een antecedent al gebruik te maken van een conclusie in het consequent. Van dat laatste is hier geen sprake.
Beide bovenstaande punten zouden, zeker voor iemand die geschoold is in de wiskunde (en ik heb de indruk dat je dat bent), overduidelijk moeten zijn. Dat je toch gebruikt maakt van dergelijke redeneringen versterkt alleen maar mijn gevoel dat je niet serieus bezig bent. Mvg, Trewal 1 jan 2016 18:10 (CET)
Trewal, ik zou graag zien dat je speculaties over minder oorbare motieven mijnerzijds, achterwege laat. Me beperkend tot de inhoud, kom ik tot het volgende:
A. Dat de verwijzing met 'deze rij' niet een cirkelredering tussen antecedent en consequent tot gevolg heeft, wil natuurlijk niet zeggen dat die verwijzing wél correct is. (Dat laatste beweer jij ook niet.)
B. Op 31 dec 2015 21:33 schreef je:   "als je het eerste deel van de zin anders schrijft, dan klopt de verwijzing in het tweede deel niet meer. [....] dat klopt, daarom moet je het eerste deel van de zin gewoon zo laten staan,...."   Ik vroeg je, en vraag je opnieuw: bij welke stap (van a tot e in mijn opsomming) in het 'anders schrijven van het eerste deel van de zin' gaat de kloppende verwijzing over in een niet-kloppende?   Je antwoord zal wat duidelijk kunnen maken over het al dan niet fout zijn van de huidige artikel-zin.  Hesselp (overleg) 1 jan 2016 22:04 (CET)
Je motieven zijn mij geheel onbekend en ik speculeer daar niet over. Ik geef slechts aan hoe ik denk over jouw manier van overleggen. Als je wilt duidelijk maken dat de huidige artikelzin fout is, doe dat dan aub en kom niet met allerlei varianten waar ik een fout in moet zoeken, maar beperk je tot de inhoud, nl. de huidige artikelzin, en geef aan wat daarin fout is. Zoals ik al heb aangegeven, ben ik in eventuele varianten en fouten in die varianten helemaal niet geïnteresseerd voordat vaststaat dat de huidige artikelzin fout is. Mvg, Trewal 1 jan 2016 22:26 (CET)
De verwijzing met 'deze rij' in de huidige artikelzin blijft  fout  taalgebruik, het wordt op deze manier ónnodig een zoekplaatje. De implicatie moet ook in de niet-inverse volgorde te lezen zijn, zonder aanpassing van een verwijzing.   E.e.a. volgt ook uit jouw uitleg (28 dec 2015 10:42) bij de huidige artikelzin: "Die uitspraken [A,B,C,D] worden door de [huidige artikel-]zin als volgt gekoppeld: D → (A ≡ B ≡ C)."   Zónder de inversie. Hesselp (overleg) 2 jan 2016 17:44 (CET)
Niks "fout taalgebruik". In taal is het normaal dat een verwijzing later in de zin komt dan datgene waarnaar wordt verwezen. Men schrijft niet "Hij is dik, want Piet eet teveel", maar "Piet is dik, want hij eet te veel", ook al is het eerste deel "Piet is dik" een gevolg van het laatste "Piet eet te veel". De zin "Piet is dik, want hij eet te veel" hoeft dan ook niet 'verbeterd' te worden naar "Piet eet te veel en daarom is hij te dik". Ook je stelling dat een implicatie zonder aanpassing van een verwijzing ook in de niet-inverse volgorde te lezen moet zijn, slaat nergens op. En hoezo "zoekplaatje"? Zoals gezegd komt er in de zin maar eenmaal het woord "rij" voor, afgezien van de verwijzing "deze rij". Mvg, Trewal 2 jan 2016 18:39 (CET)
Het Piet-voorbeeld van Trewal brengt me tot een, lijkt me, extreem duidelijk voorbeeld ter illustratie van de fout in de artikelzin.
"Annie is te dik en Piet is te dik, aangezien deze jongen te veel eet. Dat laatste volgt uit....".
Kan dit toch rechtgepraat worden, of is dit niet vergelijkbaar met
"De H-reeks divergeert en de H-rij heeft geen som, aangezien de partieelsommem van deze rij......"  ? Hesselp (overleg) 2 jan 2016 20:43 (CET)
Het is mij extreem duidelijk dat "Annie is dik" niet equivalent is aan "Piet is dik". Ook is mij extreem duidelijk dat in jouw voorbeeldzin het woord "jongen" niet voorkomt (behalve in de verwijzing) en dat daarom die verwijzing vreemd overkomt. Dat maakt mij samen extreem duidelijk dat je voorbeeld ter illustratie geen juiste weerspiegeling is van de zin in het artikel. Wederom een flauwekulredenering, lijkt me. Mvg, Trewal 2 jan 2016 20:58 (CET)
Het al dan niet equivalent zijn van de uitspraken A en B, heeft bij mijn weten geen invloed op het al dan niet correct zijn van de verwijzing met 'deze rij' in de door de artikelzin beschreven implicatie. Die artikelzin blijft dus fout, omdat het vergelijkbare "Annie is dik en Piet is dik, aangezien deze Piet te veel eet."   krompraat is. Hesselp (overleg) 4 jan 2016 01:05 (CET)
Het al dan niet equivalent zijn van A en B geeft aan dat jouw voorbeeld geen juiste weerspiegeling is van de zin in het artikel. Dat is wat ik beweerde, niet wat jij in de eerste zin van je reactie schrijft. "Deze Piet" in je nieuwe voorbeeld is inderdaad krompraat. Naar personen die bij naam genoemd worden, wordt in het algemeen niet verwezen met "deze Piet" of "die Annie" (uitzonderingen daargelaten als er meerdere Pieten of Annies zijn), maar met "hij" of "zij". Als er meerdere mannen of vrouwen in de zin genoemd worden en het niet duidelijk zou zijn naar welke persoon "hij" of "zij" verwijst, dan wordt de naam herhaald en wordt er niet verwezen (bijv. "Jan is slank en Piet is dik, aangezien Piet te veel eet en Jan niet" vs. "Annie is slank en Piet is dik, aangezien hij te veel eet en zij niet"). Dat alles heeft echter niets meer met de artikelzin te maken, waar slechts van een enkele rij wordt gesproken waar volkomen correct met "deze rij" naar wordt verwezen. Ter overweging nog het volgende: als je de verwijzing "deze rij" in een zin waar verder maar van een enkele rij gesproken wordt 'dus' fout vindt, dan vind je blijkbaar ook je verwijzing "die artikelzin" in de laatste zin van je reactie fout en/of krompraat, ook al wordt er maar van een enkele artikelzin gesproken in de voorgaande tekst. Ik denk daar anders over. Wat mij betreft is er taalkundig niets mis met jouw zin, en ook niet met de artikelzin.
Ter afsluiting: de discussie over deze ene artikelzin heeft ondertussen lang genoeg geduurd zonder dat er enig zicht is op consensus over de taalkundige juistheid. Voortzetten van deze discussie lijkt me daarom zinloos en ik ga er dan ook geen tijd meer in steken. We verschillen gewoon van mening, en het ziet er naar uit dat dat zo zal blijven. Dat betekent niet dat je nu maar je aanpassing door kunt voeren met als reden dat er geen tegenstand meer is! Die tegenstand, die op deze overlegpagina al meermaals kenbaar is gemaakt, met verwijzing naar richtlijn WP:BTNI, is en blijft er wel. Mvg, Trewal 4 jan 2016 11:17 (CET)
Zit er een verschrijving in de eerste zin van Trewal, 4 jan 2016 11:17 ?
Dan over je voorbeeldzin "Jan is slank en Piet is dik, aangezien Piet te veel eet en Jan niet". Veel beter vergelijkbaar met de bewuste artikelzin is het kortere: "Jan is dik en Piet is dik, aangezien Piet te veel eet." Zou iemand dat correct noemen?
Na jouw 'Ter overweging...' noem je mijn verwijzing met 'die artikelzin' vanuit het consequent van een implicatie met een enkelvoudig antecedent. Echter, in de artikelzin gaat het om een verwijzing vanuit het antecedent van een implicatie maar een meervoudig consequent (de H-reeks heeft geen som en de H-rij heeft geen som). Dat maakt het verschil.
Overigens verdwijnen alle leeshobbels bij de kortere variant (na een tussenkopje "Niet sommeerbaar"):
"De harmonische reeks Σn =1,2,···(1/n) heeft geen som, de harmonische rij (1/n)n =1,2,··· evenmin.
Zowel het één als het ander volgt uit de vergelijking van ...". Mvg. Hesselp (overleg) 4 jan 2016 16:59 (CET)
Antwoord op je eerste vraag: Nee. En daar wil ik het zoals gezegd bij laten. Mvg, Trewal 4 jan 2016 17:09 (CET)
Ik stel voor de hele zin te vervangen door "De som van deze reeks is oneindig". Algemene zaken horen in Reeks (wiskunde). - Patrick (overleg) 31 dec 2015 19:19 (CET)
Maar het artikel heet nu eenmaal (niet voor niets, neem ik aan) Harmonische rij. En dus mag z'n hoofdeigenschap toch wel (liefst als éérste) genoemd worden? Hesselp (overleg) 31 dec 2015 19:28 (CET)
Dat de som van de elementen oneindig is, is in de eerste plaats een eigenschap van de reeks. In het eerste deel van het artikel kunnen eigenschappen van de rij behandeld worden die niet te maken hebben met het optellen van elementen. - Patrick (overleg) 31 dec 2015 19:42 (CET)
Je stelt dit als een persoonlijke opvatting van jezelf. Heb je daar ook onafhankelijke, betrouwbare bronnen bij? Ik vind het kul. Als je gelijk zou hebben, waarom is de titel dan niet Harmonische rééks? Vanwege de hoofdeigenschap die in de optel-sfeer ligt.   Vraag maar aan Bob.v.R of hij z'n nee tegen het opheffen van de blokkade kan intrekken, dan kun je het veranderen.
PS Bij het artikel Meetkundige rij heeft jarenlang onderaan een link gestaan naar een parallel-artikel Meetkundige Reeks. Weet jij of ik de versies van dat artikel, plus de discussie over het verdwijnen ervan, nog ergens boven water kan krijgen?
Hesselp (overleg) 31 dec 2015 20:10 (CET)
Zo te zien werd van 2005 tot 2010 gelinkt naar een redirect die terugverwees, en is er geen pagina Overleg:Meetkundige reeks geweest. - Patrick (overleg) 31 dec 2015 20:41 (CET)
Het is gewoon een indeling: opteleigenschappen = reekseigenschappen, en overige eigenschappen. - Patrick (overleg) 31 dec 2015 20:47 (CET)
Er blijkt dus wél, vijf jaar lang, een pagina Meetkundige reeks geweest. Je bevestigt dat, meen ik, ook. Mijn vraag blijft of je me kunt aanwijzen waar/hoe ik de versies-historie van die pagina kan opduikelen; jij hebt heel veel meer ervaring dan ik in de wiki-techniek.
Wat anders. Door Trewal werd hier gesteld (28 dec 2015 10:42):   "De H-reeks heeft geen som" is betekenisloos. (Later wat gerelativeerd door te stellen dat 'som' in verschillende betekenissen gebruikt wordt.)  Terwijl ik van jou/Patrick begrijp dat je grote voorkeur hebt voor:   "de reeks heeft geen eindige som".   boven   "de rij heeft geen eindige som"  Zo wordt het voor mij lastig laveren. Hesselp (overleg) 2 jan 2016 12:45 (CET)
Er is nooit een artikel Meetkundige reeks geweest. Vanaf 2005 is dit al een doorverwijzing naar het artikel Meetkundige rij, dat al sinds 2004 bestaat. Zie de geschiedenissen hier en hier. Mvg, Trewal 2 jan 2016 14:24 (CET)
Bedankt, Trewal. Ik was op het verkeerde been gezet door de link in Meetkundige rij, van 20 juni 2008 tot 10 aug 2010, naar een (spook?-)artikel Meetkundige reeks. Op 10 aug 2010 zegt Paul-MD als opmerking op de geschiedenis-pagina: "link naar eigen pagina verwijderd". Dus: opgelost.Hesselp (overleg) 2 jan 2016 15:33 (CET)

Tekstwisselingen op 1 en 14 mei 2016[bewerken]

Voor de achtergrond van beide versie-wisselingen van het artikel, zie hier en hier. -- Hesselp (overleg) 14 mei 2016 20:16 (CEST)

Voor beschouwingen over spatiëring rond 'math'- notaties in lopende tekst, zie hier; de vragen aldaar aan Madyno van 28 feb 2016 17:19 (CET) zijn nog onbeantwoord. -- Hesselp (overleg) 15 mei 2016 14:47 (CEST)

"De harmonische boventoonreeks is blijkbaar een reeks en geen rij."[bewerken]

Gisteren (21 mrt 2018) schreef ErikvanB het hierboven in het kopje herhaalde in z'n bewerkingssamenvatting bij een mini-correctie. Dat is voor mij aanleiding tot het volgende:
Het is helemaal niet fout om 'harmonische boventoonRIJ' te zeggen in plaats van 'harmonische boventoonREEKS'.  De woorden 'rij' en 'reeks' zijn in veel gevallen volledig synoniem; in bepaalde situaties - zoals hier - is 'reeks' verreweg het meest gebruikelijke.
Wat anders is of je bij niet-harmonische boventonen (gezegd wordt dat die bij -bijvoorbeeld- een kerkklok zijn waar te nemen) wel van een 'reeks' kunt spreken?  Bij de 'reeks van harmonische boventonen' is sprake van een theoretische constructie van onbepaald veel discrete toonhoogten, bij ieder nummer (N-element) één.
Bij de niet-harmonische boventonen lijkt de zaak heel anders te liggen. Afhankelijk van de gebruikte detectie-apparatuur zal het aantal te detecteren boventonen ('bijgeluiden'?) kunnen wisselen, en dus heeft niet elke boventoon z'n eigen plaats/nummer in een geordende 'reeks'.
In geval ErikvanB het hier mee eens is, zou hij dan "harmonische boventoonreeks" willen veranderen in "reeks van harmonische boventonen"? Dat laatste suggereert m.i. een stuk minder sterk (dan 'harmonische boventoonreeks') dat er ook een - bij die klok behorende - reeks van niet-harmonische boventonen zou bestaan. -- Hesselp (overleg) 22 mrt 2018 19:54 (CET)

Opmerkingen over details[bewerken]

@Madyno. Je hebt de tekst nauwkeurig nagelopen, zie ik. Prima. Vier opmerkingen:
- Is het, gezien het gebruik van de benaming "harmonische rij" zowel in enge/unieke zin als verderop in ruimere zin, niet beter om de openingzin te formuleren als: "In de wiskunde staat de harmonische rij voor de rij: ..." ? (Of: ...wordt met...bedoeld de rij: ...)
- Vind je jouw wijzigingen in de spatiëring in r.5 een verbetering? Ik niet. Of zijn er (doorslaggevende?) conventies die meer variatie in de spatiëring in de weg staan?
- In r.6 lijkt me cursivering van 'harmonische getallen' op z'n plaats. (Net als "harmonische reeks" in r.11. Nog wat beter vind ik daar: "...reeks heet de harmonische reeks.")
- In de sectie 'Meer algemeen' had ik v=0 juist uitgesloten. Omdat dat de uitzondering zou zijn die niet een naar 0 convergerende rij geeft. Heb jij een tegen-argument? -- Hesselp (overleg) 25 okt 2018 22:59 (CEST)

1.Oke, anders geformuleerd. 2.Na elke komma consequent een afgedwongen spatie, wat wil je nog meer? 3. Het begrip 'harmonisch getal' heeft al een lemma en verschijnt hier dus niet als iets nieuws. Harmonische reeks heeft slechts een doorverwijzing. 4.Eens, heb ik aangepast. 5. Foutje. Madyno (overleg) 26 okt 2018 19:53 (CEST)
1, 3 en 4: okee.
2. Wat ik 'nog meer' wil? Maximale leesbaarheid. Je noemt geen conventies die het alternatief in de weg staan. De spaties rond de plustekens zijn hier storend.
5. Jouw 'Foutje' begrijp ik niet.
6. De voorlaatste zin in 'Meer algemeen' doet een expliciet recept verwachten. Vind je beter? Of, zonder de haakjes, in drie etages (lijkt mij wat minder).
7. Het 'echter' vervangen door het (minder stijve) 'maar', leidt hier tot het ónjuiste: "geen enkele harmonische rij heeft nooit een ...". Compromis (?) zonder 'echter' of 'maar' als een aparte zin: "Een harmonische rij is nooit sommeerbaar (heeft nooit een convergerende partieelsommenrij)." -- Hesselp (overleg) 26 okt 2018 21:10 (CEST)
@Madyno. Mijn commentaar bij je (niet toegelichte) edits:
2. Je noemt geen conventies die het makkelijker leesbare alternatief in de weg staan.
6. Je geeft geen reden voor je keuze voor een impliciete formule. Een expliciet recept sluit het meest direct aan bij de tekst-opmerking; dat weegt m.i. zwaarder dan het uitsparen van een stel haakjes. En dan is er ook nog BTNI.
7. 'Partieelsommenrij' is in deze context minstens zo begrijpelijk als (de mondvol) 'rij van partiële sommen': BTNI. En je keuze voor het onverwachte en mijns inziens onnodige meervoud "van de harmonische rijen" begrijp ik niet. -- Hesselp (overleg) 26 okt 2018 23:41 (CEST)
Vergelijk:
-- Hesselp (overleg) 28 okt 2018 12:38 (CET)

De door Hesselp zonder consensus (zoals altijd bij Hesselp) geplaatste formule betekent een enorme verslechtering in de leesbaarheid, ten opzichte van de formule die er stond. Bij deze heb ik de verslechtering dan ook ongedaan gemaakt. Bob.v.R (overleg) 28 okt 2018 14:13 (CET)

Voor het expliciete term-recept zie ik drie varianten. Wie heeft een voorkeur voor één van deze drie? Argument?
(a) (b) (c)
-- Hesselp (overleg) 28 okt 2018 15:38 (CET)
Om te beginnen stel ik vast dat Hesselp voor de zoveelste keer aan het editwarren is. Dit helpt bepaald niet bij het voeren van overleg. Bob.v.R (overleg) 28 okt 2018 19:42 (CET)
Ik zie hier geen argumenten genoemd waarom het onlogische (niet direct bij de tekst-zin aansluitende) impliciete alternatief, wenselijker zou zijn dan elk van de drie expliciete recept-varianten a, b en c. Dus lijkt hier op z'n minst BTNI de doorslag te geven. -- Hesselp (overleg) 28 okt 2018 20:39 (CET)
Dan moet je toch nog eens de eerste zin van de bijdrage van Bob.v.R van 28 okt 2018 14:13 (CET) opnieuw lezen, want daar staat een duidelijk argument genoemd. Van implicatie is bovendien geen sprake. Alle genoemde varianten zijn wiskundig volledig equivalent en alle geven ook expliciet exact dezelfde relatie tussen , en weer. De eenvoudigste (en daarmee meest leesbare) representatie van die relatie is de door Madyno gegeven variant. Mvg, Trewal 29 okt 2018 00:06 (CET)
I. Op de door Trewal genoemde plaats geeft Bob.v.R zijn (niet toegelichte) kwalificatie over uitsluitend receptvariant b. Terwijl receptvariant c hier, punt 6 en hier als kandidaat genoemd is.
Mijn motivatie voor deze edit met de zinnen "Ik zie hier geen argumenten genoemd waarom het onlogische (niet direct bij de tekst-zin aansluitende) impliciete alternatief, wenselijker zou zijn dan elk van de drie expliciete recept-varianten a, b en c." en "Het overleg laat nog steeds geen argumenten zien ten nadele van de nu geplaatste variant van het t(n+2)-recept." is dus wél geldig.
II. We zullen het er waarschijnlijk over eens kunnen zijn dat de impliciete formule (het 'Madyno-alternatief') typografisch voor een buitenstaander net een tikje regelmatiger oogt dan receptvariant c. (Het kan overigens nóg fraaier: met 2/t(n+1) als linkerlid.) Dat is hier echter niet het zwaarst wegende punt.
En ja, alle vier de voorstellen geven 'wiskundig' dezelfde relatie weer tussen drie opvolgende termen. Maar het Madyno-alternatief doet dat in een impliciet gepresenteerde ('verstopte') vorm, terwijl de voorafgaande tekst-zin een expliciet recept (een 'opgeloste vergelijking') doet verwachten. Dat laatste is door de auteur van deze artikel-sectie bedoeld, en heeft daarmee ook nog BTNI-rechten.
Impliciete t(n+2)-formule: Expliciet t(n+2)-recept (c):
-- Hesselp (overleg) 29 okt 2018 09:02 (CET)
De voorafgaande zin doet helemaal geen "recept" of "opgeloste vergelijking" verwachten. Die zin stelt slechts dat een harmonische rij bepaald wordt door de eerste twee termen. Alle varianten geven dezelfde relatie weer en die relatie geeft aan dat een harmonische rij door de eerste twee termen wordt bepaald. De weergave van Madyno is van die varianten de eenvoudigste, en zijn aanpassing is daarmee een duidelijke verbetering van het artikel. Mvg, Trewal 29 okt 2018 10:41 (CET)
Trewal, je noemt het Madyno-alternatief eenvoudiger dan receptvariant c. Ik vraag je: op grond waarvan? Want er valt geen enkel ander verschil te ontdekken dan dat c een expliciet recept geeft voor elke volgende term, en 'Madyno' niet. Dat maakt c, zeker voor een minder wiskundig ervaren lezer, makkelijker te volgen. -- Hesselp (overleg) 29 okt 2018 11:35 (CET)
Zoals je uit de discussie kunt opmaken, doel ik met "eenvoudiger" op de leesbaarheid, wat jij zelf omschrijft als "net een tikje regelmatiger oogt". Mvg, Trewal 29 okt 2018 14:16 (CET)
Dat 'een tikje regelmatiger' slaat alleen op de vorm (wat ook blijkt uit het 'oogt'). Maar 'makkelijkste leesbaarheid' slaat in de eerste plaats op 'makkelijkste begrijpbaarheid', dat is echt wat anders, en wat dat betreft bestrijd je (nog?) niet dat de receptvariant c het wint. Je zult ook weten (las ik niet ergens dat je wiskunde je vak noemt?) dat een door een vergelijking gegeven relatie tussen variabelen, niet altijd in elk ervan eenduidig oplosbaar is. Dat pleit voor de expliciete weergave.
En het zal een lezer lang niet altijd duidelijk zijn dat het vermelden van een uitdrukking voor het omgekeerde van de algemene rij-term, in plaats van een uitdrukking voor die algemene term zélf, uitsluitend gebeurde op esthetische gronden. Die lezer (ikzelf ook!) heeft de neiging daar - tevergeefs - iets anders achter te zoeken. Dat is simpel te voorkómen.
Ja? -- Hesselp (overleg) 29 okt 2018 15:10 (CET)
Geen idee wat je met "Ja?" bedoelt, want er gaat aan dat "Ja?" geen vraag vooraf. Mijn argumenten heb ik gegeven en over jouw argumenten heb ik mijn visie al gegeven. Verdere herhaling heeft geen nut. Mvg, Trewal 29 okt 2018 16:08 (CET)
Dat "Ja?" was door mij bedoeld als een uitnodiging aan jou (en evt. anderen) om je instemming, dan wel een beargumenteerde niet-instemming, te geven op mijn zinnetjes "Dat pleit voor de expliciete weergave." en "Dat is simpel te voorkomen."
Op het 'makkelijkste begrijpbaarheid' ga je niet in (je vorige reactie betrof het 'eenvoudiger leesbaarheid' in de zin van 'eenvoudiger ogen/eruit zien'). En op de verwarringsmogelijkheid door de formule voor de 'omgekeerde term' ga je evenmin in. Jouw visie op beide punten lees ik hier dus níét.
PS. Ik vroeg in Wikipedia:Café Exact om opinies. -- Hesselp (overleg) 29 okt 2018 16:43 (CET)
Beide bevatten 3 omgekeerde termen. De formulering van Madyno bevat 3 simpele omgekeerde termen, elk met niet-samengestelde noemer. Jouw formulering bevat 2 simpele omgekeerde termen met niet-samengestelde noemer en een derde omgekeerde term met een noemer die is samengesteld uit twee andere omgekeerde termen. Twee omgekeerde termen binnen een derde omgekeerde term dus. De verwarringsmogelijkheid dáárvan lijkt mij beduidend hoger dan die van drie niet-samengestelde, simpele omgekeerde termen. Niet alleen is de formulering van Madyno dus 'eenvoudiger leesbaar' maar bovendien het 'makkelijkste begrijpbaar'. Mvg, Trewal 29 okt 2018 17:37 (CET)
Bij je eerste vier zinnen: allemaal tot je dienst, die statistiek kon ik ook maken. Maar je negeert, alweer, het de mist in sturen van de lezer als gevolg van het onverwachte omgekeerde linkerlid. Het is moeilijk voorstelbaar dat er lezers zijn die zullen vermoeden wat daar de achtergrond van is. Zolang je blijft doen alsof jij dat niet ziet, zal ik blijven proberen je dat duidelijk te maken. De algemene term laat zich nu eenmaal niet eenvoudiger in z'n voorgangers uitdrukken, daar kan niemand wat aan doen, en dat hoeft niet verstopt te worden. Daarom is variant c zeker niet slechter dan de Madyno-vorm, en heeft dus voldoende recht om in die artikel-sectie te staan. -- Hesselp (overleg) 29 okt 2018 21:00 (CET)
Het omgekeerde linkerlid heeft in elk geval tot gevolg dat de formule beter leesbaar is en evenwichtiger oogt op de pagina. — Zanaq (?) 29 okt 2018 21:27 (CET)
Zanaq. Over het 'evenwichtiger oogt op de pagina' ben ik het met je eens: zie hier de eerste zin na label "II.". Maar er is een belangrijker aspect. Als je kijkt naar de mogelijkheid tot verwarring, en naar de eenvoudigste toegang tot de informatie die de voorafgaande zin nader toelicht, dan is dat omgekeerde linkerlid een struikelblok. Dus in díé zin in elk geval niet 'beter leesbaar'. -- Hesselp (overleg) 29 okt 2018 22:06 (CET)
Als jij denkt dat de lezer al verward raakt door een simpele omgekeerde linkerterm, hoe kun je dan concluderen dat hij minder verward zal raken door de extra complexiteit die wordt veroorzaakt door een omgekeerde term met een noemer die weer is samengesteld uit twee andere omgekeerde termen? Je gaat dan volkomen voorbij aan de mogelijkheid tot verwarring die die onnodig complexe constructie met zich mee kan brengen. Mvg, Trewal 29 okt 2018 22:43 (CET)
Trewal. Hoe ik dat kan concluderen? Ik zal proberen dat nog eens duidelijk te maken:
Om te weten te komen hoe een volgende rij-term uit de twee voorafgaande ontstaat, zal de lezer in beide situaties zich 'het omgekeerde van het verschil van twee breuken' moeten voorstellen. Bij de Madyno-vorm komt daar nog extra bij de verwarring die de onnodig niet-opgeloste vergelijking geeft. -- Hesselp (overleg) 29 okt 2018 23:18 (CET)
Volgens mij sta je volkomen alleen met die zienswijze. Mvg, Trewal 29 okt 2018 23:40 (CET)
Ik sluit me aan bij de opmerking van Bob.v.R in diens edit hierboven van 28 okt 2018 14:13 en het was dus volgens mij terecht dat Bob.v.R de verslechtering van de leesbaarheid (daarvoor gedaan door Hesselp) terugdraaide. - Robotje (overleg) 29 okt 2018 23:26 (CET)

Om het even over een andere boeg te gooien: waarom zouden we de canonische simpele vorm niet uitbreiden met uitleg in de vorm van de opgeloste vergelijking? (Wederom de tip om niet te vervangen maar uit te breiden.) — Zanaq (?) 30 okt 2018 08:26 (CET)

Voor die boeg lijkt me wel wat te zeggen, zie artikel-bewerking. Is de 'canonisch méést simpele vorm' niet -- Hesselp (overleg) 30 okt 2018 09:15 (CET)
Die bewerking doet niet wat Zanaq voorstelde: je breidt nu niet de simpele vorm uit met een uitleg in de vorm van de opgeloste vergelijking, maar juist andersom... Op deze manier is het eerder meer verwarrend, dan een verduidelijking. Mvg, Trewal 30 okt 2018 10:09 (CET)
Ik heb de bewerking van Hesselp dan ook maar teruggedraaid. - Robotje (overleg) 30 okt 2018 10:13 (CET)
Trewal, Zanaq. De versie met het expliciete recept als eerste voorkomt het hier al meermalen genoemde (en niet weerlegde) bezwaar van de door de lezer op die plaats niet verwachte onopgeloste vergelijking. Welk inhoudelijk argument pleit tegen die volgorde? De opgeloste vorm van een vergelijking wordt in zekere zin toch ook gezien als 'simpeler' dan een niet-opgeloste? -- Hesselp (overleg) 30 okt 2018 11:20 (CET)
Hesselp denkt zo te zien nog steeds dat hij het alleenrecht heeft om te kunnen bepalen of zijn bezwaar weerlegt is. Hij ziet keer op keer een consensus die er niet is of hij ziet weer eens een duidelijk omschreven tegenargment van een ander totaal over het hoofd. Het patroon herhaald zich, als het niet in het straatje van Hesselp past dan bestaat het niet, heeft hij een argument dan kan alleen hij bepalen dat zijn argument weerlegt is; iets dat (bijna) noot zal optreden. Dat schiet niet op zo. Het lijkt me beter dat Hesselp zich beperkt tot de overlegpagina om daar argumenten aan te voeren, en verder afblijft van het artikel. - Robotje (overleg) 30 okt 2018 11:43 (CET)
En intussen is Hesselp een editwar begonnen. Ik had al aangegeven in de bewerkingssamenvatting "Dat overleg kan ook gaan over een teruggedraaide versie." Ondanks dat bezwaar niet weerlegt is (en nu bepaal ik eens wanneer een bezwaar weerlegt is), blijft hij toch doordrammen. - Robotje (overleg) 30 okt 2018 17:21 (CET)
Dit is inderdaad niet geheel wat bedoeld werd met uitbreiden. En we bieden de Stelling van Pythagoras ook niet aan als c = sqrt(a^2 + b^2) maar als a^2 + b^2 = c^2. — Zanaq (?) 30 okt 2018 21:51 (CET)
Zanaq. Wat jij aanduidt met "de canonische simpele vorm" zou ik niet een 'stelling' willen noemen, al vind ik je vergelijking met de situatie bij 'Pythagoras' aardig gevonden. Het een en ander bracht me nog weer op een andere bewijs-variant voor de bewering in de voorafgaande zin; zie de 'nu' geplaatste artikel-versie. De 'canonische simpele vorm' als uitgangspunt heeft nu nog weer een andere gedaante, en wel direct aansluitend bij de definitie van een harmonische rij als zijnde een 'omgekeerde gelijke-afstands-rij'. Zit er zo meer logica in? -- Hesselp (overleg) 31 okt 2018 00:22 (CET)
Noem ik het ergens een stelling? In elk geval lijkt de verduidelijking van Madyno meer op wat mij voor ogen stond. — Zanaq (?) 31 okt 2018 17:09 (CET)
Zanaq. Bij je "Noem ik het ergens een stelling?":
Het leek er wel op. Want je bezwaar hier tegen de volgorde van de expliciete en de impliciete formule in deze versie van mij leek je hier ("ook") te ondersteunen met de situatie bij de Stelling van Pythagoras. Ik meende daaruit op te kunnen maken dat je het eerste geval óók als zoiets als een stelling zag.
Bij je "...lijkt de verduidelijking van Madyno meer op ...":
Je vroeg hier om extra 'uitleg in de vorm van de opgeloste vergelijking'. Staat die er nu niet, in mijn laatste versie? En vind jij dat het tonen van de formule met 2/t(n) als linkerlid iets relevants toevoegt aan die uitleg? (Ik niet.) Zo ja, wat? -- Hesselp (overleg) 31 okt 2018 23:03 (CET)
Een van de meest bekende vergelijkingen die het meest bekend is in onopgeloste vorm heet nu eenmaal zo: de naam is hier irrelevant. Het sleutelwoord is toevoegt. — Zanaq (?) 1 nov 2018 06:57 (CET)

Zanaq. Als je bij 'toevoegen' denkt aan het inlassen van een tussenstap in het bewijs van de bewering voorafgaand aan de "Want..."-zin: Want uit ..., ofwel volgt en dus
dan sta ik daar niet achter. Een encyclopedie is geen lesboek. Het toevoegen van het volgende lijkt me wél op z'n plaats:

Voor elke harmonische rij geldt dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren.
Elke harmonische rij is monotoon dalend, en convergeert naar ...
Bezwaren? -- Hesselp (overleg) 1 nov 2018 15:23 (CET)

Wmb is elke extra verduidelijking welkom. Tegen uitbreiden bestaat meestal minder bezwaar dan tegen (integrale) vervanging. Diepe inhoudelijke bemoeienis en inzichten hoeven over dit onderwerp niet van mij verwacht te worden: ik kijk vooral naar leesbaarheid, stijl en het bewerkingsproces. — Zanaq (?) 1 nov 2018 18:50 (CET)


Bij wijzigingen door Madyno, 31 okt 2018[bewerken]

I. Bij de slotzin van de hoofdtekst. Het besliste "is geen harmonische rij" suggereert absolute zekerheid. Terwijl er best ruimere definities te geven zijn waar de benaming 'harmonische rij' niet bij zou misstaan. Tot recent was de Wikipedia-definitie heel veel beperkter, en bronnen met een ruimere definitie zijn ook te vinden.

II. Bij Madyno's alternatief voor de "Want ..."-zin. Dit alternatief rammelt m.i. aan nogal wat kanten:
- Het "Want..." geeft aan dat het voorafgaande verklaard zal gaan worden. Hat "Aangezien..." heeft hier niet die rol.
- "de verschillen ..... constant is": hier klopt iets niet.
- "Volgt" suggereert een implicatie in een redenering, niet hetzelfde als een herformulering zoals hier. - De tussenstap vanaf "zodat", weliswaar een aardig ogende formule, is hier niet aan de orde bij het verklaren/toelichten van het 'helemaal bepaald door'.
- Het "d.w.z. het omgekeerde van een term ..." sluit minder aan dan gesuggereerd bij de formule erboven.

Het met één of twee stappen verlagen van alle indices, is me om het even.
Als Madyno hier geen zwaarderwegende voordelen kan noemen voor zijn alternatief vergeleken met de "Want..."-versie, lijkt BTNI hier op z'n minst van toepassing.

PS. Vraag, aan ieder: Is er ooit discussie geweest over de merites van "slash-breuken" versus "(horizontale) breukstreep-breuken" ? Is het een 'vrije kwestie' ? Is hier beslist slechter dan -- Hesselp (overleg) 31 okt 2018 16:04 (CET)

Madyno, je doet niet eens een poging om de door mij genoemde 'rammelpunten' te weerleggen. Dat geeft geen steun aan je artikelversie. ('Verschil' ipv. 'verschillen' is een verbetering.) -- Hesselp (overleg) 31 okt 2018 23:03 (CET)

Wie denk je dat ik ben, Pipo de Clown? Madyno (overleg) 31 okt 2018 23:08 (CET)

Grappig: Consensus[bewerken]

Het is grappig te zien dat Hesselp zowel BTNI als gebrek aan consensus aanvoert als reden voor zijn editwarring. Misschien zie ik iets over het hoofd, maar ik zie nergens consensus voor de edits van zijn hand. Wel de gebruikelijke muren van slecht leesbare tekst. The Banner Overleg 29 okt 2018 10:48 (CET)

Bij het vermeende weggevallen zijn van "omdat ... is."[bewerken]

Trewal. Bij een eerste blik leek me je aanvulling niet onlogisch. Maar na nog eens rustig lezen van eerste en tweede zin samen, zie ik dat de tweede zin in formulevorm wil illustreren wat in de eerste zin in woorden is gedefinieerd. In die opvatting lijkt me jouw aanvulling minder goed te passen. De bedoeling van die tweede zin zal mogelijk duidelijker zijn bij vervanging door (let op 'dus'): "Elke harmonische rij is dus te noteren (met als . . . ". Opinies...? -- Hesselp (overleg) 31 okt 2018 11:42 (CET)

Het was niet mijn aanvulling, maar jouw oorspronkelijke tekst; ik plaatste slechts anderhalve zin terug die bij een vorige bewerking abusievelijk verdwenen waren. Wat er na die bewerking overbleef was een halve, onafgemaakte zin en ook het specifieke geval, dat a=0 en v=1 DE harmonische rij oplevert, werd niet langer genoemd. Voel je vrij om je oorspronkelijke tekst (met expliciet 'omdat') door een alternatief (met impliciet 'dus') te vervangen. Ik zie de noodzaak niet, want beide geven immers hetzelfde aan. Als je het verandert, laat dan wel de verwijzing naar het specifieke geval a=0 en v=1 'DE harmonische rij' staan aub. Mvg, Trewal 31 okt 2018 12:42 (CET)
Trewal. Je hebt volkomen gelijk. Ik zat ernaast met dat 'vermeende weggevallen', ik had niet diep genoeg naar de oorzaak gezocht, mijn excuses. De hele regel was (had ik) inderdaad bij het invoegen van wat nieuws, per abuis geskipt.
Over de keuze tussen de 'omdat'-versie en de 'dus'-versie. De tweede lijkt me kernachtiger, korter, en niet minder informatief. Dus mijn voorkeur gaat daar nu naar uit, maar ik wacht nog even op verdere opinies. -- Hesselp (overleg) 31 okt 2018 13:29 (CET)
Ik zag nu pas dat de verwijzing naar het specifieke geval (DE harmonische rij) toch nog niet op z'n plaats teruggekomen was. Alsnog gecorrigeerd. Hopelijk nu goed; sorry. -- Hesselp (overleg) 2 nov 2018 11:45 (CET)

Bij bewerking 31 okt 2018 00:57 door Bob.v.R: "minder kans op misinterpretatie"[bewerken]

Tegen het toevoegen van "geen enkele" heb ik geen bezwaar (hoewel ik blijf vinden dat het hier overbodig is).
Als eerder gezegd: 'Partieelsommenrij' is in deze context minstens zo begrijpelijk als (de mondvol) 'rij van partiële sommen' . Met uit meerdere losse woorden bestaande begripsbeschrijvingen zijn vaak minder makkelijk vlot lopende zinnen te maken. Verder zal hier BTNI van toepassing zijn. -- Hesselp (overleg) 1 nov 2018 11:07 (CET)

Rij van partiële sommen is beter leesbaar, mede omdat er dan indien toepasselijk makkelijk duidelijke links kunnen worden ingevoegd. — Zanaq (?) 1 nov 2018 18:57 (CET)
Zanaq. Kun je hier ook aangeven waaróm volgens jou rij van partiële sommen beter leesbaar is dan partieelsommenrij (afgezien van de door jou veronderstelde betere mogelijkheid tot links) ?
De mogelijkheid om 'makkelijke duidelijke links in te voegen' lijkt hier overigens nauwelijks een rol te spelen: noch 'partiële som' noch 'partiële' laat zich linken (als ik het goed zie). -- Hesselp (overleg) 1 nov 2018 20:25 (CET)

Bij bewerking 31 okt 2018 om 10:26 door Daaf Spijker: "verschillen van"[bewerken]

'Verschillen van' lijkt me wiskundige vaktaal: de verzameling van de verschillen van de getallen a, b, c, bevat de getallen a-b, b-a, a-c, c-a, b-c en c-b .
Acceptabel lijkt me (ik zal het laten staan als iemand het invoert): "Want uit het gelijk zijn van de verschillen tussen de ..." .
Maar ik zie als toch nog net wat beeldender: "Want uit het gelijk zijn van de afstanden tussen de ..." . (Natuurlijk beide zónder onderstrepingen.) -- Hesselp (overleg) 1 nov 2018 11:07 (CET)

Niets mis met wiskundige vaktaal in dit verband, zeker niet als Verschil (wiskunde) ook gelinkt is. Verschil tussen 1 en 2 klinkt als vage kleutertaal. De afstanden tussen is al beter, maar is niet zo gebruikelijk en niet zo precies gedefinieerd als verschil in de wiskunde). — Zanaq (?) 1 nov 2018 18:55 (CET)
Maar dan afstanden niet linken naar Afstand of naar Afstand (wiskunde), lijkt mij. En (@Hesselp) als alle wiskundige vaktaal uit dit artikel verwijderd wordt, blijft er niet veel over. Overigens, een term in een partieelsommenrij (ook kleutertaal?) zou ik zeker geen partieelsommenrijterm willen noemen. En hierbij laat ik het, omdat de discussie weinig meer met encyclopediewiskunde te maken heeft, lijkt mij. Daaf Spijker overleg 1 nov 2018 19:18 (CET)
(Na bewerkingsconflict) Is 'een partieelsom' niet een duidelijke aanduiding voor 'een term in een partieelsommenrij' ? ("De vierde partieelsom van de harmonische rij is gelijk aan ....") -- Hesselp (overleg) 1 nov 2018 19:51 (CET)
Die kende ik niet. Dan is het gebruik van de term afstand erg verwarrend als niet Afstand (wiskunde) bedoeld wordt. — Zanaq (?) 1 nov 2018 19:21 (CET)
(Echt mijn laatste...?) Ach, toen ik voor het eerst 'partieelsommenrij' las, moest ik zelfs even nadenken, en wat bleek, het is zelfs geen nederlandsgeschrevenwikipedialemma. -- Daaf Spijker overleg 1 nov 2018 19:30 (CET)
Voor 'rij van partiële sommen' vind ik evenmin een Wikipedialemma (voor 'partiële som' overigens ook niet). -- Hesselp (overleg) 1 nov 2018 19:43 (CET)
Partiële som. En het is niet gebruikelijk (wenselijk) om in kort bestek meerdere keren naar hetzelfde te linken, zeker ook met een verhullende linktekst. In dit geval - zo de bewerking al wenselijk is - is het beter naar bijvoorbeeld Convergentie (wiskunde) te linken. Welke ideeën van anderen bedoeld worden is niet geheel duidelijk, in elk geval was er nauwelijks steun voor het vervangen van rij van partiële sommen door partieelsommenrij. — Zanaq (?) 1 nov 2018 21:51 (CET)
Dat met 'Partiële som' direct gelinkt kan, was een verrassing voor me; ik weet niet langs welke weg ik dat zelf had kunnen vinden. Met "ideeën van anderen" in mijn bewerkingssamenvatting 1 nov 2018 10:09‎, doelde ik op opmerkingen op de overlegpagina en alternatieven op de artikelpagina vanaf 25 okt 2018. Het lijkt me juister om niet te spreken van vervangen van 'rij van partiële sommen', maar van terugplaatsen van 'partieelsommenrij'. Want die laatste aanduiding (nu met een link naar Reeks (wiskunde)) was gekozen in de eerste tekst van de sectie 'Meer algemeen'. Ik zie graag inhoudelijke argumentatie bij gemelde voorkeuren. -- Hesselp (overleg) 1 nov 2018 23:45 (CET)
Ok, in dat geval was er nauwelijks steun voor het weghalen van rij van partiële sommen en terugplaatsen van partieelsommenrij. Bovendien is er ook een <br> gebruikt die ongewenst is en waarom monotoon dalend naar rij linkt is ook niet duidelijk. Ik denk dat de wijziging het beste ongedaan gemaakt kan worden. — Zanaq (?) 2 nov 2018 06:44 (CET)
Zanaq. Bij jouw "<br> is ongewenst" (nogmaals). Ik kan geen directe vermelding vinden in Wikipedie-normen/aanbevelingen van het ongewenst zijn van <br> in deze specifieke situatie. Noem ze hier, als ze er zijn. En kun jij een andere mogelijkheid aangeven om op een (niet ingesprongen) nieuwe regel te beginnen zónder extra witruimte tussen de regels? Welke norm zou zeggen dat zo'n (naar mijn idee heel normale) extra-wit-loze overgang op een nieuwe regel, ongewenst is? -- Hesselp (overleg) 3 nov 2018 10:39 (CET)
Geen idee of het ergens staat, maar een (niet ingesprongen) nieuwe regel beginnen zónder extra witruimte tussen de regels is (in lopende tekst) niet gebruikelijk, niet volgens de WP:Conventies. — Zanaq (?) 3 nov 2018 11:17 (CET)
Zanaq. Het 'niet gebruikelijk' lijkt wel waar te zijn, al kom ik het af en toe, ook op artikelpagina's wel tegen. Er komen wel méér 'niet gebruikelijke' dingen voor op artikelpagina's, als het een enigszins zinnige functie heeft lijkt me daar niks op tegen.
Naar welke van de twintig secties in WP:Conventies baseer je je 'niet gebruikelijk' ? Het in sectie 18 genoemde 'Zo min mogelijk HTML' is hier niet van toepassing wegens het afwezig zijn van een alternatief. -- Hesselp (overleg) 3 nov 2018 13:57 (CET)
Ik wacht de visie van de Arbcom ten deze met enig vertrouwen af; zie [2] -- Hesselp (overleg) 4 nov 2018 08:48 (CET)
Het is niet de bedoeling op een nieuwe regel te beginnen zonder witregel. — Zanaq (?) 4 nov 2018 14:07 (CET)
@Zanaq. "Het is niet de bedoeling". Jij zegt het. Bronnen? Of het Arbcom-oordeel afwachten. -- Hesselp (overleg) 4 nov 2018 16:09 (CET)

De 'gelijke-verschillen'-zin blijft zorgen voor gepuzzel. De versie van Bob.v.R 2 nov 2018 06:53‎ heeft het over 'omgekeerden van paren van ...' en niet over 'omgekeerden van termen'. Lijkt me minder fraai. Waarmee ik nu kom tot het volgende:
"Want uit het constant blijven van het verschil tussen de omgekeerden van opvolgende termen, volgt voor een drietal : (verschillenformule) en daaruit (oplossingsformule)." Bezwaren? -- Hesselp (overleg) 2 nov 2018 11:45 (CET)

Het is niet duidelijker. — Zanaq (?) 3 nov 2018 08:06 (CET)
Zanaq. Betreft je korte commentaar ("Het is niet duidelijker.") de vergelijking van de suggestie aan het slot van mijn OP-bijdrage 2 nov 2018 10:46 (Nog een alternatief voor de 'gelijke-verschillen'-zin.), met Bob.v.R's voorafgaande artikelversie 2 nov 2018 06:53‎ (taal) ?
Zo niet, op welke vergelijking bedoelde je dit commentaar wél? -- Hesselp (overleg) 3 nov 2018 10:39 (CET)
Er werd gevraagd naar bezwaren tegen voorgaande. — Zanaq (?) 3 nov 2018 11:18 (CET)
@Zanaq. Nog even in extenso. Je stelde:
"Want uit het constant blijven van het verschil tussen de omgekeerden van opvolgende termen, volgt voor een drietal : ..." is niet duidelijker dan
"Want uit het gelijk zijn van de verschillen tussen de omgekeerden van paren van de opeenvolgende termen uit ofwel ..." . Ja? -- Hesselp (overleg) 3 nov 2018 13:57 (CET)

Bij bewerking 2 nov 2018 18:50‎ door Madyno[bewerken]

Bij het bewijs voor (de verklaring van, de toelichting bij) "is ... helemaal bepaald door de eerste twee termen" in de Madyno-versie zie ik de volgende minpunten:
- De rol van 'namelijk' in de eerste tekstregel hangt in de lucht. ("Het verschil ... is namelijk constant, ..., zodat ..." is geen welgevormde zin.)
- Na het 'dat wil zeggen ' wordt niets gezegd. Wat volgt na "d.w.z." is ook geen gevolgtrekking uit het voorafgaande.
- De passage tussen 'zodat' en 'buren' speelt geen rol in het bewijs. Als de hier vermelde eigenschap van een harmonische rij relevant is voor het lemma, dient het op een aparte plaats te staan en niet het bewijs te onderbreken. (Het harmonisch-buren-gemiddelde zijn van de term zelf lijkt me relevanter dan het rekenkundig-omgekeerde-buren-gemiddelde zijn van z'n omgekeerde.)
- Het tweede "d.w.z." is ook misplaatst: 2/t(n) is niet 'het omgekeerde van een term'.
- Zeven regels ipv. twee (voor de Hesselp-versie), zonder dat het bewijs er duidelijker van wordt.

Kun je (Madyno) hier aangeven welke bezwaren je hebt tegen 'mijn' versie? -- Hesselp (overleg) 2 nov 2018 23:20 (CET)

Ik denk dat je beter

kunt    spreken van het
wel-misvormde harmonisch-burenzijn-gemiddelde-rekenkundig-omgekeerde-verschil.
Vind je niet ook wel ?... Madyno (overleg) 2 nov 2018 23:30 (CET)

Bij Zanaq's bewerkingssamenvatting 3 nov 2018 08:12. Mijn keuze voor "n+2" en niet "n+1" (of "n") sluit beter aan bij het voorafgaande 'de eerste twee termen'; de termformule geldt dan ook voor n = 1. Dat is net wat logischer. -- Hesselp (overleg) 3 nov 2018 10:39 (CET)
Het is raar als dat niet in het artikel is uitgelegd. 2 komt na 1, en het vermelden van 2 roept de vraag op wat er met 1 gebeurd is. Eerder zou men dan een geval n + m verwachten. Wederom een geval van uitbreiden, niet vervangen. — Zanaq (?) 3 nov 2018 11:21 (CET)
@Zanaq. In 'mijn' versie staat expliciet aangegeven ('uitgelegd') dat de verklaring bij het voorafgaande "helemaal ... termen" gegeven wordt aan de hand van het drietal t(n), t(n+1), t(n+2); Het hier beginnen bij index n lijkt me het meest logisch, want het resultaat geldt dan voor n vanaf 1. Dus het ontgaat me wat je nog verder bedoelt met "Het is raar ..." . -- Hesselp (overleg) 3 nov 2018 13:57 (CET)
De term met "n" is de algemene term. Er wordt daar ook gesproken over het harmonisch gemiddelde van de buren van elke term. Dan is het veel logischer om voor de middelste term de algemene term "n" te gebruiken, met aan weerszijde de buren "n-1" en "n+1". Dat de formule dan niet geldt voor n=1 is ook te verwachten: de term n=1 is namelijk niet het harmonisch gemiddelde van zijn buurtermen, want de term n=1 is de enige met maar één buur. De versie van Madyno toont ook expliciet aan dat het omgekeerde van een term het gemiddelde is van de omgekeerden van zijn buren. Die versie is daarom te prefereren. Mvg, Trewal 3 nov 2018 11:34 (CET)
@Trewal. Mijn reactie op je "Er wordt daar ook gesproken over ..." blijft:
De passage tussen 'zodat' en 'buren' speelt geen rol in het bewijs. Als de hier vermelde eigenschap van een harmonische rij relevant is voor het lemma, dient het op een aparte plaats te staan en niet het bewijs te onderbreken. (Het harmonisch-buren-gemiddelde zijn van de term zelf lijkt me relevanter dan het rekenkundig-omgekeerde-buren-gemiddelde zijn van z'n omgekeerde.)
Wie vermelding van deze burengemiddelde-eigenschap van omgekeerde termen in het artikel gewenst acht, kan daar een geschiktere plaats voor zoeken; met indices naar keuze. Maar mix het niet met het aan de orde zijnde 'bewijsje'.
Wie de sprong tussen beide formulevormen in 'mijn' bewijsversie te groot vindt (ik niet) zou kunnen tussenlassen. (Ook een 'uitbreiding'.) -- Hesselp (overleg) 3 nov 2018 13:57 (CET)

Ik vind de wijzigingen van H bepaald geen verbeteringen. Neem alleen al de formulering: Uit het constant blijven... etc. Madyno (overleg) 4 nov 2018 12:34 (CET)

Madyno. (1) Vind je het beter (en zo ja, op grond van welke argumenten) om de gemiddelde-eigenschap van omgekeerde termen, als onderbreking van de afleiding van de recursie-formule te hebben staan? (Met 'recurrentie' in de samenvatting was 'recursie' bedoeld.) (2) Wat is er mis met Uit het constant blijven... ? (3) "Etc." is geen argument, wees concreet graag. -- Hesselp (overleg) 4 nov 2018 13:46 (CET)
Ik heb over het algemeen moeite met het lezen van de formuleringen van Hesselp. De hier genoemde formulering is daarop geen uitzondering. Ook de opmerking van Hesselp hierboven kan ik niet goed plaatsen: "Het harmonisch-buren-gemiddelde zijn van de term zelf lijkt me relevanter dan het rekenkundig-omgekeerde-buren-gemiddelde zijn van z'n omgekeerde". Die twee zijn toch equivalent: het harmonisch gemiddelde van de twee buurtermen is immers gedefinieerd als de inverse van het rekenkundig gemiddelde van de inversen van die buurtermen. Daartegenover staat de zonder moeite leesbare wijze waarop Madyno een en ander verwoordde. Dus graag terugplaatsen wat mij betreft. Mvg, Trewal 4 nov 2018 13:58 (CET)
@Trewal. (1) Wat is er mis met mijn formulering Uit het constant blijven... ? De variant 'constant' ipv. 'gelijk' vond ik in deze eerdere bewerking, net iets pregnanter/beeldender. En dat 'blijven' ipv. 'zijn' heet bij professionals actie-taal (wat anders dan kleutertaal), en wordt over het algemeen als beter leesbaar beschouwd. (2) "Die twee zijn toch equivalent" schrijf jij. Ja, helemaal waar, maar een aantal commentatoren lijken toch beide genoemd te willen zien (voor mij is het noemen van het harmonisch gemiddelde van de termen zelf hier meer aan de orde dan het noemen van het rekenkundig gemiddelde van de omgekeerde termen). -- Hesselp (overleg) 4 nov 2018 16:09 (CET)

Bij bewerking 4 nov 2018 20:36‎ door Madyno[bewerken]

Madyno. Je noemt je bewerking beter geformuleerd en sytematischer. Ik zie echter juist een flink aantal manco-punten in vergelijking met de vorige versie:
1. Na "helemaal bepaald door de eerste twee termen" ontbreekt een verklaring/toelichting/bewijsje van die bewering (zoals in de vorige versie vanaf 'Want ...'; het achterwege laten van zo'n verklaring lijkt me ongewenst).
2. In de 'Aangezien'-zin suggereert het eerste 'volgt' een implicatie. Je tekst is echter moeilijk als zodanig te lezen omdat bij dat 'volgt' geen voorafgaand 'uit ...' of '...waaruit' te vinden is.
3. In de 'Aangezien'-zin licht je de implicatie-stap "...waaruit volgt dat elke term ..." niet toe, al suggereert de dubbelepunt dat wél.
4. In de 'Aangezien'-zin is de slotformule geen rechtstreekse weergave van het voorafgaande "dat elke term ... is van beide buren"; wél van het niet in tekst genoemde rekenkundig gemiddelde zijn van een omgekeerde term van twee omgekeerde buren.
5. Waar je een weergave van 'de algemene term' aankondigt, volgt geen formule die als zodanig beschouwd kan worden, maar een weergave van een recursieve betrekking (een recursie-formule).
6. De functie van het woordje 'dan' ontgaat me. Is de formule niet algemeen geldend?
-- Hesselp (overleg) 4 nov 2018 23:28 (CET)

Nou, nou, je hebt het er maar moeiijk mee.Madyno (overleg) 4 nov 2018 23:32 (CET)
Het 'aangezien' van Madyno slaat duidelijk terug op de schrijfwijze direct erboven met de termen , dus dat is correct. Met 'dan' bedoelt Madyno dat een conclusie wordt getrokken uit het direct voorafgaande. Terzijde: tegen het pas ietsjes later noemen van het harmonisch gemiddelde heb ik overigens geen bezwaar, mits daar wel de bijbehorende formule bij wordt vermeld. Bob.v.R (overleg) 5 nov 2018 00:00 (CET)

Bij bewerking 5 nov 2018 14:08 door Hesselp[bewerken]

Het subkopje verduidelijkt de scheiding tussen definities en eigenschappen.
Bij de Bob.v.R-versie van de verklaring van de eigenschap 1. (a) Een stuk langer, maar in geen enkel opzicht informatiever of duidelijker. (b) Het beginnen met 'Want...' maakt direct duidelijk dat er een verklaring voor het 'helemaal bepaald door' volgt. Jouw volgorde maakt het nodig om de bewering nog eens te herhalen (met: "dat iedere term ... voorafgaande termen"). (c) Welk voordeel heeft de keuze voor indices vanaf n-1 ? Bij mijn keuze (vanaf n) gelden de formules vanaf n = 1, het meest logische. (d)Als "constant blijven" door meerderen bezwaarlijk gevonden wordt, zal ik een wijziging naar "constant zijn" laten staan.

Bij de Bob.v.R-versie van eigenschap 2. (e) Aan het "Tevens is te zien" heeft een lezer bitter weinig. (f) Het beginnen met "Voor elke harmonische rij" wijst er nog even op dat het niet alleen gaat om een eigenschap van DE harmonische rij. (g) De niet-expliciete vorm van de formule is niet optimaal lezer-vriendelijk, past niet precies bij het "elke term ...is" uit de formulering in woorden. -- Hesselp (overleg) 5 nov 2018 15:09 (CET)

Vraag bij regel zin 1. Ik kan de zin niet zien van de toevoeging "dus de rij met algemene term ". De link bij het vooafgaande "rij" lijkt zeker voldoende. Wie noemt hier argumenten voor handhaving? --

Van de HesselP-Vraag-bij-regel-1-opmerking zie ik de zin niet in. Regel 1 gewoon handhaven. Madyno (overleg) 5 nov 2018 20:11 (CET)
@Madyno. Ik zie je inhoudelijke argumentatie voor het beter zijn van 'jouw' versie tegemoet. Graag voor de drie betreffende zinnen apart, dat overlegd makkelijker. -- Hesselp (overleg) 6 nov 2018 18:10 (CET)
Het "regel 1" in mijn vorige bijdrage was bedoeld als "zin 1"; graag als zodanig lezen. -- Hesselp (overleg) 6 nov 2018 18:14 (CET)
De zin niet zien is geen reden iets weg te halen: misschien ziet iemand anders de zin wel. Ik raad nogmaals aan vooral toevoegingen te doen en het materiaal dat er al staat met rust te laten tenzij het onzin is. — Zanaq (?) 6 nov 2018 18:34 (CET)
@Zanaq. "De zin niet zien is geen reden om iets weg te halen." Zou kunnen. Maar het door niemand genoemd worden, na verzoek, van voor een lezer relevantie informatie die door die halfzin zou worden toegevoegd, is dat wél. Pure doublures, pal na elkaar, zijn in een encyclopedie ongewenst. Het woord 'rij' is recent gelinkt (Zanaq, 29 okt), en de 'algemene term' staat al eerder in dezelfde zin. Met het 'met rust laten' van zo'n doublure is geen lezer gediend. -- Hesselp (overleg) 6 nov 2018 22:41 (CET)
Welke doublure? Ik zie geen doublure. In die zin wordt maar éénmaal geschreven dat de rij de rij met algemene term is. Mvg, Trewal 6 nov 2018 23:22 (CET)
Argument voor handhaving: het gaat bij Wikipedia om de lezer, en niet om het rupsje-nooit-genoeg-gedram. Verder hierbij het vriendelijke verzoek aan Hesselp om in het vervolg geen grammaticafouten te maken in overlegbijdragen. Bob.v.R (overleg) 7 nov 2018 00:16 (CET)
De algemene term kan behalve met een horizontale breukstreep, ook met een schuine breukstreep worden genoteerd. Dat staat er, maar daar wordt geen voor de lezer relevante informatie mee toegevoegd. Vandaar 'doublure'. En het introduceren van de letter 'a' ter aanduiding van de al geïntroduceerde harmonische rij heeft evenmin enige relevantie. Als er geen relevantie is, moet die halfzin weg. -- Hesselp (overleg) 7 nov 2018 00:12 (CET)
Bij deze bewerking door Bob.v.R. De letters a en v zijn traditie voor een rekenkundige rij, een andere letter in de beginzin ligt dus meer voor de hand. -- Hesselp (overleg) 7 nov 2018 09:04 (CET)
Als iets traditie is, dan is dat toch iets om ook mogelijk na te volgen, en misschien bovendien op een toepasselijke plaats díe informatie ook toe te voegen? — Zanaq (?) 7 nov 2018 15:50 (CET)
Dat 'navolgen' is precies waar ik naar streef. De traditie is niet moeilijk te bebronnen: [3], [4], [5], [6]. -- Hesselp (overleg) 7 nov 2018 16:25 (CET)
Ik zie in geen van die 4 bronnen beschreven dat de notatie met en de traditionele manier zou zijn. Verder zijn de 1e en 2e bron feitelijk dezelfde... Het enige dat je aantoont is dat deze bronnen de notatie met en gebruiken, niet dat dat de traditionele manier is. Het is ook vrij eenvoudig om tegen die bronnen andere te plaatsen die juist een andere notatie gebruiken, bijv. deze, die en gebruikt, deze, die en gebruikt, deze, die en gebruikt en deze, die en gebruikt. Overigens is jouw 'argument' over het traditie zijn van een bepaalde notatie voor een meetkundige rij evengoed toepasbaar op de notatie van een rij in het algemeen, zoals die in zin 1 staat. In plaats van jouw bezwaar, zou je evengoed kunnen schrijven: "De letter a in de beginzin is traditie voor de notatie van een rij, een andere letter in de beschrijving van de rekenkundige rij ligt dus meer voor de hand." Mvg, Trewal 7 nov 2018 18:03 (CET)
Trewal. Tegenover jouw relativerende opmerkingen stel ik het volgende:
1. Bij het verwijzen naar bronnen met t0, u0, u1 als varianten voor a. Die varianten zijn niet aan de orde, omdat het hier gaat om een beschrijving van een rekenkundige rij waarbij voor de eerste term een aparte letter (zonder index) gebruikt wordt. Je bron met b voor de eerste term is een hoge uitzondering.
2. Bij je twijfel bij het 'de traditionele manier zijn' van de letter a. In oudere wiskundeboeken vind ik uitsluitend a. Ik noem enkele bekende auteurs met jaartal (precieze vindplaatsen kan ik leveren): Jacob de Gelder 1825; Jan Versluys 1892; Wijdenes 1915 ("De eerste term wordt altijd a genoemd"); Van Thijn 1931; Alders 1940 ("De beginterm duidt men dikwijls aan met a"); Stoelinga/Van Tol 1955 ("Men noemt der eerste term in plaats van t1 ook dikwijls a"); Coster/Van Dop/Streefkerk 1967; Bos/Lepoeter 1968.
3. Bij je 'de notatie van een rij in het algemeen'. De drie gangbare letternamen zijn hier a, t en u. In zin 1 is er echter helemaal geen reden om een letter te kiezen voor 'een rij in het algemeen'. Het gaat daar alleen om één specifieke rij. De letter H (of h) lijkt me voor die 'harmonische rij' het meest in aanmerking te komen. -- Hesselp (overleg) 7 nov 2018 21:52 (CET)
Ad 1. Onzinargument. Het gaat om een beschrijving van een rekenkundige rij, punt. Wat je daar achter schrijft "waarbij voor de eerste term een aparte letter (zonder index) gebruikt wordt" slaat nergens op.
Ad 2. Ik zie geen argument, noch een bron die beweert dat de schrijfwijze die jij voorstaat specifiek voor rekenkundige rijen de traditionele en nu geprefereerde schrijfwijze zou zijn.
Ad 3. Onzinargument. Ook bij het beschrijven van een specifieke rij is de notatie zoals die in het artikel Rij (wiskunde) wordt beschreven en zoals die in de eerste zin wordt overgenomen, gangbaar. Mvg, Trewal 7 nov 2018 22:14 (CET)
Ad 1-bis. Niks 'onzinargument'. Het gebruik van t1 (of u0 of u1) zou hier een volstrekt overbodige complicatie vormen. Voor het introduceren van een letternaam voor de bedoelde algemene rekenkundige rij, náást de letternaam voor de bedoelde algemene harmonische rij, is hier geen reden.
Ad 2-bis. Bron voor het traditioneel zijn van de letternaam a: P. Wijdenes, D. de Lange, Leerboek der Algebra, deel III 2e druk 1915, P. Noordhoff-Groningen. p. 63 "De eerste term wordt altijd a (aanvangsterm) genoemd, ...". Wil je van de andere 7 aangestipte bronnen ook specificaties zien? Bron voor het nu geprefereerd zijn van de letternaam a: de Google-statistiek geeft tot nu toe vijfmaal a (ook nog [7]) tegen eenmaal b, geen andere indexloze letternamen. De door mij voorgestane 'schrijfwijze specifiek voor rekenkundige rijen' lijkt me in deze context de meest wenselijke; alternatieven (afgezien van c ipv. a, waarom juist c zal een lezer zich afvragen) zijn in dit overleg niet getoond.
Aanvulling op bronnen voor letter a als beginterm voor een RR:
- J. de Gelder [8] deel II, p. 168
- P.G.J. Vredenduin, A. van Haselen Nieuwe Algebra III, 9e druk 1968, p. 73: "De eerste term stellen we veelal voor door a ".
- J.H. Wansink, Algebra II, 5e druk 1966, p. 113. -- Hesselp (overleg) 8 nov 2018 11:03 (CET)
Ad 3-bis. Niks 'onzinargument'. In het artikel Rij (wiskunde) slaat de notatie op een willekeurige RR, in zin 1 is dit niet het geval. Voor jouw gangbaar bij een specifieke rij zoals hier, ken ik - en noem jij - geen bron, Laat staan een bron voor het nu geprefereerd zijn van die notatie. Ik stel: daar zijn helemaal geen bronnen voor, want die notatie is niet preferabel. -- Hesselp (overleg) 7 nov 2018 23:53 (CET)
De door Hesselp in de inleiding van het artikel voorgestelde notatie met H zou verwarring scheppen met harmonisch getal. Het scheppen van verwarring helpt de encyclopedie niet.
De Hesselp-zinnen hierboven betreffende de keuze voor a of c, hebben betrekking op (de aanvangsterm van) rekenkundige rijen. Dit artikel gaat echter over de harmonische rij. Bob.v.R (overleg) 8 nov 2018 00:10 (CET)
Bij "zou verwarring scheppen". Het vervangen van de algemeen gebruikte a door de nooit voorkomende c schept veel meer verwarring.
Bij "gaat over de harmonische rij". Jazeker, waarvan de termen gedefinieerd zijn als omgekeerden van de - hier dus niet te vermijden - rekenkundige rij. -- Hesselp (overleg) 8 nov 2018 11:03 (CET)
Ik deel de meningen van Hesselp onder punten a-g niet en vind zijn wijzigingen geen verbeteringen. Ik zie er ook geen steun van anderen voor. Mvg, Trewal 8 nov 2018 13:26 (CET)
'Overleg' is wat anders dat alleen een oordeel wel/geen verbetering. In dit geval zal het inhouden dat argumenten gegeven worden voor:
a. het afwijzen van de kortere verwoording van de zin beginnend met "Aangezien..." ;
b. het niet als nadeel zien van het verderop in die zin herhalen van de bewering, en van het niet met "Want..." direct na de bewering aankondigen van een verklaring;
c. het niet als nadeel zien van het ongeldig zijn van de formule voor n=1;
d. (hier niet aan de orde)
e. het in de 'Tevens is te zien'-zin niet als nadeel zien van dat nietszeggende en dus storende 'tevens is te zien' ;
f. het niet als nadeel zien van het weglaten van "Voor elke harmonische rij";
g. het niet als nadeel zien van het niet precies passen van de formule bij de tekst;
h. (bij zin 1) het niet als onnodig complicerend zien van en .
-- Hesselp (overleg) 8 nov 2018 14:32 (CET)
Laten we dan een klassiek thema maar weer eens uit de kast halen: bronnen. Heb je recente, gezaghebbende en onafhankelijke bronnen voor jouw beweringen? En punt twee: probeer voor de verandering eerst eens consensus te bereiken in plaats van te editwarren. The Banner Overleg 8 nov 2018 14:43 (CET)

Bij bewerking 19 nov 2018 19:38 door Hesselp[bewerken]

Gezien het overleg in de sectie 'De argumenten onder elkaar' tussen 9 nov 2018 21:52 en 12 nov 2018 14:43, en mede gezien de Arbcom-uitspraken van 24 jul 2018 22:30 (CEST) (waarin gesteld wordt dat de beste argumentatie de hoofdrol speelt in een discussie over de inhoud, en niet de stem van een op een willekeurige overlegpagina aanwezige meerderheid) en van 15 nov 2018 10:04 (CET) is de volgende onderbouwing te geven:

Zin 1
Er zijn geen nadelen genoemd voor het vervangen van   " met algemene term "  door   " " .
Voor de wat langere en complexere variant met de dummy-variabele a zijn geen voordelen genoemd.
Bronnen voor de kortere vorm:
- WolframMathWorld
- B. Kaper, H. Norde, Inleiding in de analyse, 1996, p.181 "De rij convergeert naar 0, maar is niet sommeerbaar".
Terzijde: Ik heb nog steeds geen bezwaar tegen het laten vervallen van een aanvulling vanaf 'dus'.

Eigenschap 1 (subsectie 'Meer algemeen', vijfde zin)
Bij de nu geplaatste variant zijn geen nadelen genoemd.
Als minpunten bij de vervangen zin zijn te zien: (1) het eerste 'volgt' is taalkundig fout bij het voorafgaande 'aangezien' (bij 'volgt' past een 'uit ...'); (2) het dubbele 'volgt' in "waaruit volgt dat iedere term als volgt is vastgelegd ..." maakt dat zinsgedeelte lastig leesbaar; (3) de lengte van de zin; (4) 'omdat' is gewoner dan 'aangezien'.
Bronnen: "Korte, makkelijk begrijpbare zinnen hebben de voorkeur." (Arbcom-uitspraak, sectie 'Inhoud, structuur en vorm'). Ook: J. Renkema, Schrijfwijzer, sectie: Leesgemak / Eenvoud / Lange zinnen.

Eigenschap 2 (subsectie 'Meer algemeen', op twee na laatste zin)
De voordelen van de nu geplaatste variant A als genoemd in de sectie 'De argumenten onder elkaar', zijn daar niet bestreden.
Tegen het aangevoerde "Duidelijk blijkt waarom het woord 'gemiddelde' gebruikt wordt." pleit het juist zeer óngebruikelijk zijn van impliciete vormen als     en     ter weergave in formulevorm van een rekenkundig dan wel een meetkundig gemiddelde.
Bron voor de huidige expliciete formulevorm: [9]. -- Hesselp (overleg) 19 nov 2018 20:41 (CET)

  1. Wat leuk dat je opnieuw dat kletsverhaal ophangt over jouw deblokkade. Alleen ging dat over vandalisme en niet over bruikbare toevoegingen.
  2. In plaats van de gebruikelijk vrijwel onleesbare muur van tekst zou je ook de formulering kunnen gebruiken van "oude tekst" vs nieuwe tekst (onder elkaar). Op die manier is veel beter te zien wat voor wijzigingen je nu eigenlijk wilt hebben.
  3. In plaats van tig zaken in een edit te behandelen, zou je elk voorstel onder een apart (sub)kopje kunnen zetten en wel onderaan de pagina en niet ergens midden in.
  4. Als ik het goed zie heb je hierboven drie wijzigingen benoemd (die je, geheel in stijl, al doorgevoerd heb op de pagina). Ik ben onzeker wat de bron is voor de tweede wijziging maar de twee anderen zijn zo te zien Wiki's die vaak gezien worden als niet echt betrouwbaar. Kun je de originele bronnen geven waarop jouw voorstel gebaseerd is?
Voorbeeld:
Voorstel 1
"Oude tekst": (vul maar in)
"Nieuwe tekst": (vul maar in)
The Banner Overleg 19 nov 2018 21:23 (CET)
Noot: Ik vecht bij deze de edits aan op basis van WP:V en de twijfelachtige (= afgeleide) bronnen. The Banner Overleg 19 nov 2018 22:36 (CET)
Ik zie bij het eerste deel van de wijziging geen bronnen gegeven die alle inhoudelijke aspecten van de wijziging onderbouwen. De gegeven bron gebruikt een bepaalde vorm, maar geeft geen enkele onderbouwing dat die vorm beter zou zijn dan de vorm die er stond.
Ik zie bij het tweede deel van de wijziging geen bronnen gegeven die alle inhoudelijke aspecten van de wijziging onderbouwen. De vier genoemde punten lijken slechts opinies van Hesselp, maar ik zie geen bronnen die elk der vier punten onderbouwt. Daartegenover staat bijvoorbeeld deze tekst, die alle vier genoemde punten lijkt te weerspreken: de tekst bevat de onder 1) genoemde constructie "Aangezien [...], volgt [...]"; diezelfde tekst bevat de onder 2) genoemde constructie met dubbele 'volgt' en wel als volgt: "hieruit volgt dat [...] een Gammaverdeling volgt"; diezelfde tekst bevat lange maar duidelijke zinnen, en diezelfde tekst gebruikt 6 maal "aangezien" tegen 0 maal "omdat".
Ik zie bij het derde deel van de wijziging geen bronnen gegeven die alle inhoudelijke aspecten van de wijziging onderbouwen. De gegeven bron gebruikt een bepaalde vorm, maar geeft geen enkele onderbouwing dat die vorm beter zou zijn dan de vorm die er stond.
Zonder bronnen die alle inhoudelijke aspecten van deze wijziging onderbouwen, voldoet deze wijziging niet aan maatregel 1 van deze uitspraak. Daarom wordt deze wijziging ongedaan gemaakt.
Ook kan worden gesteld, dat Hesselp met deze wijziging maatregel 3 van genoemde uitspraak schendt: "Hesselp zal bewerkingen van andere gebruikers niet ongedaanmaken, ook niet gedeeltelijk." Dat deed hij met deze bewerking echter voor de zoveelste keer wél. Ik raad Hesselp aan niet nogmaals de maatregelen in genoemde uitspraak te schenden. Mvg, Trewal 19 nov 2018 22:59 (CET)
Reactie op Trewal, bij 'Zin 1' . Als een bron, bijvoorbeeld een leerboek, (veelvuldig) de dummyloze notatie bezigt, kan dat zeker gezien als een voorkeur van de auteur voor die notatie. Een nadere expliciete onderbouwing van die voorkeur is daar niet te verwachten, en is mijns inziens ook niet nodig om toch als bron te gelden als bedoeld in de uitspraak van de Arbitragecommissie. Ik begrijp dat Trewal dit anders ziet.
Dat het gebruiken van de korte notatie een bewuste keuze van een auteur is, zal kunnen blijken uit het elders in dezelfde tekst voorkomen van de dummy-notatie in situaties waar daar een praktische reden voor is. -- Hesselp (overleg) 21 nov 2018 15:07 (CET)
Ik zie dit inderdaad anders. Zijn er bronnen die de algemene term in de algemene notatie van een rij een 'dummy-variabele' noemen? Of is dit slechts een door Hesselp bedachte denigrerende aanduiding van het begrip 'algemene term'? Door eerst de algemene notatie van een rij te introduceren en die vervolgens nader te specificeren door de algemene term expliciet te maken, is de zin eenvoudiger te begrijpen. Een praktische reden dus, bij de introductie van het begrip 'rij' in de openingszin van het artikel. Mvg, Trewal 21 nov 2018 17:02 (CET)
Voor de twee in discussie zijnde varianten voor het nader beschrijven, aanduiden, noteren van de al middels opsomming geïntroduceerde rij, gebruikte ik de labels 'dummyloze notatie' en 'dummynotatie'. Waarom zou dat als iets denigrerends opgevat kunnen worden? De term ‘dummy-variabele’ is een puur zakelijke benaming.
De eerste intro-zin van een specifieke rij, waarin al met een link naar het algemene ‘Rij (wiskunde)’-artikel is verwezen, en waarin die specifieke rij al in opsommingsvorm (inclusief de 'algemene term') is weergegeven, is niet de meest aangewezen plaats voor een lesje rij-notaties. Dat wordt hier door een lezer niet verwacht, dat stoort dus, en dat is geheel overbodig. Nog afgezien van de vraag of je een notatie met willekeurige letters (a en n) wel de meest algemene kunt noemen. En dan blijft nog onduidelijk welke indices-aanduiding in 'de algemene notatie van een rij' dient voor te komen.
Het door Trewal genoemde "de introductie van het begrip 'rij' " hoort niet hier thuis, maar in het artikel 'Rij (wiskunde)'. -- Hesselp (overleg) 22 nov 2018 01:12 (CET)


Reactie op Trewal, bij 'Eigenschap 1' . Op elk van de vier 'minpunten' (hier, na 'Eigenschap 1') ga ik afzonderlijk in, en ik voeg nog twee 'minpunten' toe.
(1.) De combinatie van 'aangezien' en 'volgt' (in: "aangezien [...], volgt voor een drietal [...]") is hier taalkundig fout. Een correcte combinatie is ofwel "aangezien [...], geldt [...]", ofwel "uit [...] volgt [...]". De in deze tekst tweemaal voorkomende (Uitwerkingen 1-b en 5) combinatie 'Aangezien ... volgt' is te verdedigen met het argument dat het 'volgt' terugverwijst naar wat aan het 'Aangezien' voorafgaat, aangevuld met het gestelde tussen beide woorden. In de WP-tekst is dat niet het geval. (In Uitwerking 4-c is dit bij de combinatie "Aangezien [...], zien we [...]" evenmin het geval, waarschijnlijk de reden dat hier niet voor 'volgt' gekozen is.)
(2.) Het dubbele 'volgt' in "waaruit volgt dat iedere term als volgt is vastgelegd ..." is niet taalkundig fout, maar maakt dat zinsgedeelte lastig leesbaar. Hetzelfde is min of meer het geval in deze tekst, Uitwerking 4-c derde zin; voor beide situaties geldt dat het tweede 'volgt' niet een implicerende betekenis heeft.
(3.) Bij het 'minpunt' "de lengte van de zin" (het zijn 31 woorden) stelt Trewal: "deze tekst bevat lange maar duidelijke zinnen. En nogal vreemd commentaar, waar de gemiddelde zinslengte in bedoelde vergelijkings-tekst op minder dan 11 woorden uitkomt (met één zin van ook 31 woorden). En de suggestie dat zinnen in de vergelijkingstekst duidelijker zouden zijn dan de 'Want'-zin (variant C, 20 woorden) in de door Trewal afgekeurde versie, zie ik graag nog toegelicht aan de hand van mogelijke onduidelijkheden in die 'Want'-zin.
(4.) Als iemand het woord 'aangezien' in deze context prefereert boven 'omdat' (ik niet), dan heeft die iemand mijn zegen.
(5.) Als vijfde minpunt zie ik het beginnen van de zin met twee voegwoorden ('Want aangezien'). Het is een fikse puzzel om uit de rest van de 31-woorden-zin op te maken welke deelzinnen door het 'want' gevoegd worden, en welke door het 'aangezien'. Kan een van de mede-overleggers dat aangeven?
(6.) En als zesde minpunt: Het drievoudige 'volgt' in één zin hoeft niet logisch fout te zijn, maar stilistisch, en dus voor de leesbaarheid, is het hier hoe dan ook wat drakerig. (Ik blijk niet de enige die hier niet blij mee is.) -- Hesselp (overleg) 21 nov 2018 15:22 (CET)
Het overlegpatroon lijkt zich na de arbcomuitspraak niet te veranderen. Weer een berg opmerkingen die sterk de indruk geven dat Hesselp zijn inhoudelijke bijdragen vooral of zelfs uitsluitend baseert op eigen inzichten. Dat hij zijn bedenkingen tegen een zin van 31 woorden formuleert door zinnen te gebruiken die langer zijn dan dat, maakt zijn betoog niet geloofwaardiger. Ook niet erg geloofwaardig is, dat hij wel schijnt te zien dat 'volgt' terug zou verwijzen naar wat aan 'Aangezien' voorafgaat, maar dat hij bij 'Want aangezien' niet schijnt te zien dat 'Want' (een nevenschikkend voegwoord) uiteraard verwijst naar de voorgaande zin. Tja, dan is het lang zoeken, als je niet bedenkt dat een voegwoord twee zinnen kan koppelen. Want aangezien dit nevenschikkend voegwoord deze zin verbindt met de voorafgaande zin, verwijst dat nevenschikkend voegwoord helemaal niet naar iets in de 31-woorden-zin. Vreemd, dat Hesselp zoiets basaals niet weet. Want het is heel normaal dat een nevenschikkend voegwoord op die manier wordt gebruikt om een zin aan een voorafgaande zin te koppelen. Maar dat wil Hesselp kennelijk niet zien. Want aangezien dat zijn betoog onderuit zou halen, past dat niet in zijn straatje. Dus doet hij alsof hij niet weet dat een voegwoord zo gebruikt kan worden...
Op deze voet kunnen we eindeloos doorgaan met het bespreken van de persoonlijke visies van Hesselp. Maar daarmee komen we niet verder. Daarom graag bronnen voor hetgeen Hesselp als argument hanteert. Want ik zie nog geen bronnen die onderbouwen wat hij allemaal beweert. En die bronnen zijn wel nodig als hij een inhoudelijke wijziging aan het artikel wil doen. Mvg, Trewal 21 nov 2018 20:05 (CET)
Het blijft een fikse (onoplosbare?) puzzel met dat voegwoordenkoppel 'Want aangezien'. Ook als je mijn woord 'deelzinnen' (in (5.)) zou lezen als 'deelzinnen of zinnen'. -- Hesselp (overleg) 22 nov 2018 01:12 (CET)
Reactie op Trewal, bij 'Eigenschap 2' . Als een auteur kiest voor de expliciete formulevorm () ter verduidelijking van het voorafgaande "dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren", dan zal hij van mening zijn dat die vorm beter/leesbaarder is dan andere vormen (bijvoorbeeld het impliciete ). Een nadere argumentatie voor die voorkeur is van zo'n auteur niet te verwachten, en is mijns inziens ook niet nodig om toch als bron te gelden als bedoeld in de uitspraak van de Arbitragecommissie. Ik begrijp dat Trewal dit anders ziet. -- Hesselp (overleg) 21 nov 2018 15:30 (CET)
Ik zie dit inderdaad anders. Ik zie alweer niets meer dan een persoonlijke visie van Hesselp, en ik zie nog geen bronnen die onderbouwen wat hij allemaal beweert. En die bronnen zijn wel nodig als hij een inhoudelijke wijziging aan het artikel wil doen. Mvg, Trewal 21 nov 2018 20:10 (CET)

Moe[bewerken]

Ik word hier zo moe van. Madyno (overleg) 1 nov 2018 14:58 (CET)

  1. De komma in zin 1 hoort buiten de math-tags
  2. Het is goed gebruik om \ldots te gebruiken ipv ...
  3. "Elke harmonische rij is dus te noteren (met als," lijkt me een slechtere formulering dan wat er stond.
  4. Nog zo'n bedenkelijk zin: "Want uit het gelijk zijn van de afstanden tussen de omgekeerden van drie opeenvolgende termen". In een rij van termen wordt eigenlijk niet van 'afstanden' gesproken. Ook de definitie van rekenkundige rij spreekt over 'verschil'. En dan, wat zijn de afstanden tiussen drie termen p, q en r: r-q, r-p, q-r?
  5. Het HesslPbedenksel partieelsommenrij is beslist geen standaardterm.
  6. De interessante opmerking dat van de omgekeerden van drie termen, de middelste het gemiddelde is van de buren, lijkt me zeker een plaats te verdienen.

En zo zullen we wel tot in het oneindige doorgaan.
Bovenstaande opmerkingen zijn hier op 1 nov 2018 om 15:12 uur geplaatst door Madyno.

1*. Welke Wikipediarichtlijn/aanbeveling zegt dat het gebruiken van die mini-komma prevaleert boven het streven naar een zo leesbaar mogelijke regel? Ik ben soms wat allergisch voor 'hoort'.
2*. Idem, gaat 'zo leesbaar mogelijk' niet vóór? (Wat niet zegt dat \ldots niet de voorkeur kan hebben.)
3*. Gaan we weer.... In een overleg is het heel handig als je ook aangeeft op grond waarvan je tot dat 'slechtere' komt.
4*. Toch zou 'afstanden' in deze (vanwege dat 'drie' en dat 'omgekeerde' wat lastige) context voor een gemiddelde lezer hier net even makkelijker kunnen zijn. Die rekenkundige-rij-definitie noemt: het verschil tussen twéé termen. (En let op het 'tussen', Daaf Spijker)
5*. Er zijn talloos veel zéér bruikbare 'samenstellingen' die beslist geen standaardterm zijn.
6*. Die 'interessante opmerking' lijkt me net wat beter in omgekeede vorm genoemd te kunnen worden: dan kan direct de link gelegd met het verwante begrip 'harmonisch gemiddelde'. De opmerking hoort m.i. niet thuis in het (mini-)bewijs voor het "helemaal bepaald door de eerste twee termen".
Mocht je nog meer op je hart hebben, kom maar op: de kwaliteit van Wikipedia kan altijd nog verder verbeterd. -- Hesselp (overleg) 1 nov 2018 15:55 (CET)
Ad 1: de komma die achter de math-formule staat hoort niet bij de formule zelf, maar staat daar omdat de zin waarin die math-formule gebruikt wordt een komma vereist (om de bewering die eindigt met de math-formule te scheiden van de daaropvolgende deelzin die begint met "dus").
Ad 2: zoals ik in mijn bewerkingscommentaar van 31 okt 2018 11:18‎ al aangaf, is het consequent gebruik van ldots binnen dit artikel geheel volgens BTNI: elders in hetzelfde artikel werd namelijk al overal \ldots gebruikt. WP:BTNI geeft echter duidelijk aan dat consequentie een uitzondering vormt op "bij twijfel niet inhalen".
Toch plaats Hesselp weer zijn versie terug, zonder daar enige onderbouwing bij te geven. Dat is inderdaad om moe van te worden. Mvg, Trewal 2 nov 2018 09:23 (CET)
Trewal. Jij hebt in detail naar de punten en komma's gekeken, daarom vraag ik je waarom in de sectie 'Harmonische reeks' na de eerste zin een punt ontbreekt, en na de voorlaatste zin een punt volgt op de ldots (mogelijk beide niet gezien?).
Tweede vraag. Madyno stelt dat de tekstformaat-komma in regel 2 na "..." daar 'hoort' te staan. Jij stelt dat een op "..." eindigende zin géén zinseinde-punt dient te krijgen. Zijn voor beide bindende of adviserende regels aan te wijzen? Het lijkt me inconsequent, en dát mag niet van Wikipedia-regels. Verder vind ik die komma in regel 2 storend en volstrekt overbodig voor de leesbaarheid. -- Hesselp (overleg) 2 nov 2018 19:23 (CET)
Ik heb niet naar alle punten en komma's gekeken en ik heb die onderdelen niet geschreven. Op je eerste vraag kan ik dan ook geen antwoord geven. Die vraag kun je beter aan de auteur van die onderdelen stellen.
Als je vindt dat de komma in regel 2 storend en volstrekt overbodig voor de leesbaarheid is, waarom plaatste je die komma dan in hemelsnaam hier weer terug, nadat ik hem hier had verwijderd, en gaat er vervolgens tegen mij over zeuren ...?
Als ... aan het eind van een zin staat komt er geen punt achter, zie beletselteken en ook dit taaladvies. Over het gebruik van een komma na ... wordt in dat advies niets gezegd. Van inconsequentie is geen sprake, want een vergelijking tussen de situatie met komma en die met punt, is als het vergelijken van appels met peren. Mvg, Trewal 2 nov 2018 20:09 (CET)
@Trewal. Nog over interpunctie. "Voor en achter een beletselteken komt doorgaans een spatie." volgens [10]. De komma staat niet bij de uitzonderingen (vraagteken, uitroepteken, beletselteken tussen haakjes). -- Hesselp (overleg) 4 nov 2018 11:09 (CET)

Vragen, vragen, vragen! Meer dan tien wijzen kunnen beantwoorden. En lappen tekst op de overlegpagina, en de ene revert na de andere. Wie zal hierbij betrokken zijn? Eén keer raden.Madyno (overleg) 2 nov 2018 21:20 (CET)

Dat moet haast wel een Rupsje Nooitgenoeg zijn. Bob.v.R (overleg) 8 nov 2018 21:15 (CET)

Nutteloze edits[bewerken]

Ik heb de edit van Hesselp maar weer eens teruggedraaid omdat hij wilt echter eerst overleg zien, dus bij deze. Er is trouwens ook geen consensus. The Banner Overleg 8 nov 2018 12:31 (CET)

Wat mij betreft is er uberhaupt geen verwarring bij het gebruik van in de definierende eerste zin en a als eerste term in de later ter sprake komende rekenkundige reeks. Maar als iemand in de eerste zin een andere letter wil gebruiken: prima. Ik heb wel bezwaar tegen de veranderingen die H. per se wil doorvoeren in de 2e alinea van de sectie "Meer algemeen". Ik vind de terminologie: "het constant blijven" kleutertaal, en bovendien: wat blijft er constant? Is het morgen nog steeds wat het gisteren was? Bovendien vind ik het logischer om de n-de (zeg maar algemene) term te beschouwen, als harmonisch gemiddelde van z'n buren, dan alweer de (n+1)-ste. Madyno (overleg) 8 nov 2018 14:49 (CET)
@Madyno. Ik verwacht dat het 'constant blijven' eerder geassocieerd wordt met 'bij oplopend rangnummer' of bij 'verder naar rechts/omhoog gaan in de rij' dan met 'in de toekomst ook'. ('Oplopend' en 'gaan' zie ik ook als actie-taal, niet als kleutertaal.) Jij ziet dat anders, okee.
Over de keuze voor indices. Je zegt logisch te vinden: de n-de term [tn dus] als harmonisch gemiddelde van z'n buren [tn-1 en tn+1]; dat past exact bij de door mij voorgestane formuleversie voor eigenschap 2.
De toelichting bij eigenschap 1 gaat uit van een (algemeen) drietal opvolgende termen. De keuze tn, tn+1, tn+2 leidt tot een conclusie die geldt vanaf n = 1. Bij de keuze voor tn-1, tn, tn+1 is dat niet zo. Ik zie niet welk vóórdeel dit heeft. Je wilt hier laten zien dat elke term uit alleen z'n twee voorgangers te bepalen is, een voorkeur voor index n voor de directe voorganger kan ik niet ontdekken. Volgens mij zelfs geen kwestie van BTNI.
Ik schrijf nergens dat ik de (n+1)-ste term als harmonisch gemiddelde van z'n beide buren beschouw, toch? -- Hesselp (overleg) 9 nov 2018 16:34 (CET)

De argumenten onder elkaar[bewerken]

Ontbrekende argumenten kunnen hieronder per rubriek toegevoegd. Commentaar kan direct onder een argument toegevoegd.

Zin 1, variant A[bewerken]

..., dus de rij met algemene term .

Voordelen-A[bewerken]

1. Duidelijkheid (a.u.b. geen vervolgvragen van Hesselp). Bob.v.R (overleg) 10 nov 2018 04:52 (CET)

Ik zie niet welke verduidelijking het zinsdeel vanaf 'dus' geeft bij de in regel 2 gegeven opsomming (met ook al de algemene term). Wie kan dit wél aangeven? -- Hesselp (overleg) 10 nov 2018 13:15 (CET)
Tsja, Hesselp zou misschien zelfs het complete artikel als vanzelfsprekend en dus overbodig willen opvatten. Maar er zijn ook lezers en m.i. zijn veel lezers gebaat bij duidelijkheid, zelfs wanneer Hesselp het allemaal vanzelfsprekend vindt. Bob.v.R (overleg) 10 nov 2018 19:47 (CET)

2. De harmonische rij wordt zo expliciet gedefinieerd. Trewal 10 nov 2018 23:45 (CET)

Nadelen-A[bewerken]

1. Zie voordelen B-1.
2. De toevoeging vanaf 'dus' kan (in welke vorm ook) beter vervallen, want voegt hier niets toe waar de lezer wat aan heeft; het is storend.

Die toevoeging voegt zeker iets toe, namelijk een expliciete definitie van de harmonische rij. Trewal 10 nov 2018 23:45 (CET)

Zin 1, variant B[bewerken]

..., dus de rij met algemene term .

Voordelen-B[bewerken]

1. Korter; dezelfde informatie zonder de volstrekt zinloze toevoegingen die een onnodige puzzel zijn voor de lezer.

[gekopieerd uit sectie Conform de in het overleg getoonde argumenten; een stemmenverhouding is daaraan ondergeschikt. Conform BTNI.] Een lezer zou zich kunnen afvragen welke "rij met algemene term " bedoeld wordt. Het zou de oneindige rij met kunnen zijn, of de eindige rij met , of oneindig veel andere eindige of oneindige rijen met die algemene term... Mvg, Trewal 10 nov 2018 00:08 (CET)
Die mogelijkheid tot twijfel lijkt me uitgesloten, na de weergave in regel 2 en het 'dus' in regel 3. -- Hesselp (overleg) 10 nov 2018 21:21 (CET)
Noch de weergave in regel 2, noch de formulering in regel 3, geven expliciet de definitie van de harmonische rij. Mvg, Trewal 10 nov 2018 23:45 (CET)

Nadelen-B[bewerken]

1. De toevoeging vanaf 'dus' kan (in welke vorm ook) beter vervallen, want voegt hier niets toe waar de lezer wat aan heeft; het is storend.

2. De harmonische rij wordt zo niet expliciet gedefinieerd. Trewal 10 nov 2018 23:45 (CET)

Zin 1, variant C[bewerken]

..., dus de rij met algemene term .

Voordelen-C[bewerken]

1. De toevoeging n=1, 2, 3, ... maakt de beschrijving van de in regel 2 aangegeven rij volledig.

Nadelen-C[bewerken]

1. De toevoeging vanaf 'dus' kan (in welke vorm ook) beter vervallen, want voegt hier niets toe waar de lezer wat aan heeft; het is storend.

2. De harmonische rij wordt zo niet expliciet gedefinieerd. Trewal 10 nov 2018 23:45 (CET)

Nou ben ik erg benieuwd. In welk opzicht wordt de harmonische rij door de weergave in regel 2, en door "de rij met algemene term " niet expliciet gedefinieerd?
Waarom noem je "de rij met algemene term " (met die storende dummy-variabele) wél een expliciete definitie?
En welke status heeft volgens jou: "de rij " ? -- Hesselp (overleg) 11 nov 2018 00:20 (CET)
In welk opzicht is dan wél expliciet? Ik zie daar slechts de drie eerste waardes voor . Wat daar op volgt, moet men er zelf impliciet bij verzinnen, dat is immers wat hier impliceert, zoals het dat ook doet in de visualisatie van de rij met op regel 2. Die impliciete representatie verduidelijken met een andere al even impliciete uitleg voegt niets toe waar de lezer wat aan heeft; het is storend.
In welk opzicht is "de rij met algemene term " niet expliciet? Hier wordt expliciet aangegeven dat de rij bestaat uit termen , waarbij expliciet wordt aangegeven dat en dat een index is met expliciete ondergrens en expliciete bovengrens .
Wat in de laatste vraag met "status" bedoeld wordt, is mij niet duidelijk, dus op die vraag kan ik geen antwoord geven. Misschien is er onder 10 wijzen iemand te vinden die dat wel kan? Mvg, Trewal 11 nov 2018 01:30 (CET)
De door Hesselp voorgestelde formulering is evident minder duidelijk dan de huidige tekst, want minder lezers zullen begrijpen wat ermee bedoeld wordt. Bob.v.R (overleg) 11 nov 2018 12:05 (CET)
Trewal. Je meent dat de weergave/visualisering "" voor lezers onvoldoende duidelijk is. En dat de standaard-betekenis van "" als zijnde "en zó voort" bij lezers onvoldoende bekend is. Wie van de overleg-deelnemers vindt dat ook? Als dat een meerderheid is, zal een regel 3 kunnen zijn: "waarmee bedoeld is de rij .". Voor een (iets gecompliceerdere) versie met een dummy-variabele zie ik hier geen argumenten genoemd.
Bob.v.R noemt voor zijn "evident minder duidelijk" weer geen argument; waar is die dummy-variabele in de huidige tekst goed voor? -- Hesselp (overleg) 11 nov 2018 13:02 (CET)
Hesselp. Wie denk je dat ik ben? Gekke Henkie? Je ontwijkt het onderwerp door te stellen dat jij meent te weten wat ik meen dat voor lezers onvoldoende duidelijk of onvoldoende bekend is. Jij noch ik weten wat al dan niet voldoende duidelijk of voldoende bekend is voor "lezers". Ik heb het daar niet over gehad, dus verzin aub geen meningen die ik niet heb geuit om ze vervolgens als feitelijk weer te geven, maar beperk je tot het onderwerp, i.p.v. de discussie met dit soort framing een andere richting uit te sturen. Ik geef slechts argumenten voor het expliciet aangeven wat de harmonische rij inhoudt, en stel voor dat niet te doen door een tweede impliciete bewering die zich bedient van "en zó voort". Wat is immers "en zó voort", als je schrijft ? Dat is nog minder expliciet dan de ervoor staande visualisatie... Wat voegt deze nog minder expliciete uitleg volgens jou toe? Volgens mij niets. Als je het daar niet verder over wilt hebben, dan houdt voor mij de discussie op. Van vuil spel ben ik niet gediend. Mvg, Trewal 11 nov 2018 22:39 (CET)
Voor mij geldt hetzelfde. Ik heb een toelichting gegeven, maar als Hesselp die toelichting zogenaamd niet leest, dan worden er (voor de zoveelste keer) kinderachtige spelletjes gespeeld. Doe dat a.u.b. ergens anders, niet op wikipedia. Bob.v.R (overleg) 11 nov 2018 23:07 (CET)
@Trewal. Jouw "[de bedoeling van die puntjes] moet men er zelf impliciet bij verzinnen" [11] heb ik verwoord als "Trewal. Je meent dat de weergave/visualisering "" voor lezers onvoldoende duidelijk is. En dat de standaard-betekenis van "" als zijnde "en zó voort" bij lezers onvoldoende bekend is." [12] (onderstrepingen niet in originelen). Sorry, het kan aan mij liggen, maar ik zie ook nu nog niet dat jouw "men" in deze context naar wat anders kon verwijzen dan mijn verwoording 'voor/bij lezers'. Ook je toelichting maakt me geen verschil duidelijk. -- Hesselp (overleg) 12 nov 2018 15:43 (CET)

Zin 1, variant D[bewerken]

..., waarmee bedoeld is de rij .

Voordelen-D[bewerken]

1. Deze formulevorm is - volgens Trewal en Bob.v.R - evident duidelijker en wenselijker dan

Hopla, een nieuwe formulering voorstellen en daar gelijk stellen dat Ik die evident duidelijker en wenselijker vindt dan een andere waar ik commentaar op heb gegeven. Stop aub met dit soort framing. Het houdt een keer op met WP:AGF. Zvg, Trewal 11 nov 2018 22:46 (CET)
Ad 'Hopla,'. Gelieve de door mij geplaatste zin na "1." te lezen als:
"Gezien eerder commentaar van Trewal en Bob.v.R verwacht ik dat deze variant D aan hun bezwaar/bezwaren tegemoet komt." -- Hesselp (overleg) 12 nov 2018 15:43 (CET)

2. Het voegwoord 'dus' is vermeden, cf. de mening van Trewal en Bob.v.R dat de weergave in regel 2 nog niet eenduidig de harmonische rij aanduidt.

Hopla, daar gaat ie nog een keer! Waar staat mijn mening, die cf. zou zijn met deze observatie over deze door mij nog helemaal niet becommentarieerde versie? Stop aub met dit soort framing. Het houdt een keer op met WP:AGF. Zvg, Trewal 11 nov 2018 22:46 (CET)
Ad 'Hopla,'. Gelieve de door mij geplaatste zin na "2." als volgt te lezen:
"Uit Trewals bijdrage 11 nov 2018 00:30 maak ik op dat hij de weergave in regel 2 niet voldoende vindt om te dienen als volledige beschrijving van de harmonische rij. Ik meen dat dan logisch gezien het vervolg van de zin niet met 'dus' kan beginnen. -- Hesselp (overleg) 12 nov 2018 15:43 (CET)

3. Voor de beschrijving met een dummy-variabele (a, in variant A) zijn geen voordelen genoemd ten opzichte van de kortere variant D.


Eigenschap 1, variant A[bewerken]

... . Want uit het constant zijn van het verschil tussen de omgekeerden van opvolgende termen, volgt voor een drietal :

en daaruit .

Voordelen-A[bewerken]

1. Korter, zonder verlies aan informatie.
2. Geen verschuivende indices.

Nadelen-A[bewerken]

1. Er wordt geen duiding aangegeven bij de tweede formule, namelijk het feit dat iedere term is vastgelegd door de twee voorgaande termen. Bob.v.R (overleg) 10 nov 2018 04:58 (CET)

Het beginwoord 'Want' geeft aan dat in deze zin een onderbouwing volgt van de voorafgaande met woorden beschreven bewering. De door Bob.v.R bedoelde duiding in woorden van de tweede formule maakt dat voor de lezer niet duidelijker. En maakt de formule zelf evenmin duidelijker.
Een alternatief dat wel nog extra toelichting geeft zou kunnen zijn om aan variant A toe te voegen de zin: "Het herhaald toepassen van deze recursie-formule laat zien dat elke term bepaald is door t1 en t2." -- Hesselp (overleg) 10 nov 2018 13:15 (CET)
We verschillen kennelijk van mening. Ik zie bij Hesselp geen teksten die mijn argumentatie weerleggen. Bob.v.R (overleg) 10 nov 2018 14:10 (CET)
Bij "We verschillen kennelijk van mening." Nee, op dit punt niet. Het is duidelijk dat in Variant A geen beschrijving in woorden (Bob.v.R: 'duiding') gegeven wordt bij de tweede formule.
Waar verwijs je naar met "mijn argumentatie", kan die hier tussengevoegd? -- Hesselp (overleg) 10 nov 2018 23:22 (CET)
Als er door Hesselp niet wordt gedramd, dan wordt er door Hesselp wel geprovoceerd, zoals nu. Het behalen van een populariteitsprijs is bij Hesselp niet de primaire ambitie. Bob.v.R (overleg) 11 nov 2018 01:03 (CET)
En tóch ... graag antwoord op: "Waar verwijs je naar met 'mijn argumentatie', kan die hier tussengevoegd?". In een overleg-situatie is dat van belang. -- Hesselp (overleg) 11 nov 2018 13:02 (CET)

2. Het iets beeldender/meer pregnante 'constant blijven' (geen kleutertaal maar actietaal) ipv. 'constant zijn' is wenselijk.

Eigenschap 1, variant B[bewerken]

... . Want aangezien het verschil tussen de omgekeerden van twee opvolgende termen constant is, volgt voor een drietal :

,

waaruit volgt dat iedere term als volgt is vastgelegd door de twee voorgaande termen:

Voordelen-B[bewerken]

1. Bij beide formules is duidelijk waarom ze worden gegeven. Bob.v.R (overleg) 10 nov 2018 05:02 (CET)

Voor wat betreft de eerste formule is er geen verschil met variant A. De beschrijving in woorden van de tweede formule voegt géén informatie toe. Dat zou pas het geval zijn bij een toevoeging als genoemd als alternatief onder Nadelen A-1. -- Hesselp (overleg) 10 nov 2018 13:15 (CET)
Voor Hesselp lijkt het voldoende te zijn als een wiskunde-artikel bestaat uit een lijstje met kale formules. Ik zou in dat geval Hesselp aanraden om een eigen website te beginnen waarop hij zijn niet in woorden toegelichte Hesselp-lijstjes kan deponeren. Bob.v.R (overleg) 11 nov 2018 01:34 (CET)
Ik noemde hierboven als suggestie om aan Variant A toe te voegen de zin: "Het herhaald toepassen van deze recursie-formule laat zien dat elke term bepaald is door t1 en t2.". Dit geeft - in tekstvorm, Bob.v.R - nog wat extra toelichting bij de voorafgaande 'Want'-zin; méér dan de beschrijving in woorden van de tweede formule in Variant B. -- Hesselp (overleg) 11 nov 2018 13:02 (CET)
De zin 'dat iedere term als volgt is vastgelegd door de twee voorgaande termen' is een essentiële toelichting bij de erop volgende formule. Fijn dat Hesselp geen behoefte heeft aan die toelichting, maar het gaat om de lezer. Deze toelichting dient er m.i. dus bij te staan! Tegen het onder de formule plaatsen van de door Hesselp genoemde conclusie heb ik geen bezwaar. Bob.v.R (overleg) 11 nov 2018 13:46 (CET)
Het een en ander combinerend, zonder een lastig lange en ook logisch kromme zin, zou het dan variant C kunnen worden. -- Hesselp (overleg) 11 nov 2018 20:05 (CET)
Bij het 'Zo' in variant C, is niet duidelijk waarop dat 'Zo' betrekking zou moeten hebben (behalve voor de lezers die het al weten). Variant B is aanzienlijk duidelijker. Bob.v.R (overleg) 11 nov 2018 23:01 (CET)

Nadelen-B[bewerken]

1. De al genoemde eigenschap wordt in de verklarende 'Want aangezien'-zin nogmaals herhaald; overbodig dubbelop.
2. De bouw van de zin is een onmogelijke puzzel, met driemaal 'volgt'. Het 'Want' hoort niet bij het eerste 'volgt' maar bij het tweede. De logische functie van 'waaruit' is niet te vinden (de tussenzin beginnend met 'aangezien' eindigt bij de tweede komma).
3. De indices in de eindformule passen niet bij die van het begindrietal en van de eerste formule.
4. Een logischer keuze voor de indices van het drietal is ófwel beginnen bij n, ófwel eindigen bij n.
5. Zie bij Nadelen A-2.

Eigenschap 1, variant C[bewerken]

... . Want uit het constant zijn van het verschil tussen de omgekeerden van opvolgende termen, volgt voor een drietal :

en daaruit .

Zo is iedere term De laatste formule zegt dat iedere term is vastgelegd door de twee voorafgaande. Het herhaald toepassen van deze 'recursie'-formule recursie-formule laat zien dat elke term bepaald is door en .

Eigenschap 2, variant A[bewerken]

Voor elke harmonische rij geldt dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren, in formule:

.

Voordelen-A[bewerken]

1. Het beginnen met "Voor elke harmonische rij" wijst er nog even op dat het niet alleen gaat om een eigenschap van DE harmonische rij.
2. Zie nadeel B-1. De formule past rechtstreeks ('expliciet') bij het "elke term ...is" uit de formulering in woorden.
3. Het rechterlid is precies de weergave in formulevorm van 'harmonisch gemiddelde van tn-1 en tn+1'.

Nadelen-A[bewerken]

1. Nodeloos ingewikkelde formule. De lezer wordt het hier onnodig moeilijk gemaakt. (A.u.b. geen vervolgvragen.) Bob.v.R (overleg) 10 nov 2018 00:51 (CET)

De formule in deze variant A heeft minder tekens dan die in variant B: hoezo 'nodeloos ingewikkeld'? En een expliciete formule voor 'elke term (vanaf de tweede)' is logischer, en dus makkelijker te lezen dan een impliciete. Het vermijden van drie niveaus in de formule weegt daar niet tegen op. Dit rechterlid is nu eenmaal de definitie van 'harmonisch gemiddelde van tn-1 en tn+1'. -- Hesselp (overleg) 10 nov 2018 13:15 (CET)


Eigenschap 2, variant B[bewerken]

Tevens is te zien dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren:

Voordelen-B[bewerken]

1. Overzichtelijkheid van de formule. Duidelijk blijkt waarom het woord 'gemiddelde' gebruikt wordt (a.u.b. geen vervolgvragen van Hesselp). Bob.v.R (overleg) 10 nov 2018 04:37 (CET)

Zie commentaar bij Nadeel A-1. -- Hesselp (overleg) 10 nov 2018 13:15 (CET)

Nadelen-B[bewerken]

1. De niet-expliciete vorm van de formule is niet optimaal lezer-vriendelijk, past niet bij het "elke term ...is" uit de formulering in woorden.

Conform de in het overleg getoonde argumenten; een stemmenverhouding is daaraan ondergeschikt. Conform BTNI.[bewerken]

Please, Gebruiker:Hesselp, je maakt nu wel erg opzichtig duidelijk dat jij je niets aantrekt van consensus en overleg. The Banner Overleg 9 nov 2018 23:21 (CET)

Bij het noemen van "daaraan ondergeschikt" baseerde ik me op de zin "Bovendien zou bij het volgen van de brede definitie niet langer de beste argumentatie de hoofdrol spelen in een discussie over de inhoud, maar de stem van een op een willekeurige overlegpagina aanwezige meerderheid." in een Arbcom-uitspraak van 24 juli 2018 22:30 (CEST). -- Hesselp (overleg) 10 nov 2018 13:36 (CET)
Aha, cherrypicking. Helaas is het slechts een commentaar, geen deel van de conclusies/uitspraak. The Banner Overleg 10 nov 2018 19:29 (CET) Ook kan vastgesteld worden dat de bewerkingen van Hesselp geen vandalisme zijn in de enge zin zoals beschreven op Wikipedia:Vandalisme. Men zou het gedrag van Hesselp onder de brede zin kunnen scharen, maar dat is een hellend vlak. Bovendien zou bij het volgen van de brede definitie niet langer de beste argumentatie de hoofdrol spelen in een discussie over de inhoud, maar de stem van een op een willekeurige overlegpagina aanwezige meerderheid.
Een lezer zou zich kunnen afvragen welke "rij met algemene term " bedoeld wordt. Het zou de oneindige rij met kunnen zijn, of de eindige rij met , of oneindig veel andere eindige of oneindige rijen met die algemene term... Mvg, Trewal 10 nov 2018 00:08 (CET)
@Trewal. Is jouw commentaar niet beter op z'n plaats in de voorgaande sectie "De argumenten onder elkaar" ? Subsectie Zin 1, variant B, Voordelen B-1. Wil je deze verplaatsing uitvoeren? -- Hesselp (overleg) 10 nov 2018 13:36 (CET)
De voorgaande sectie is helaas zeer onoverzichtelijk. — Zanaq (?) 10 nov 2018 16:01 (CET)
Ik bewerk niet graag in andermans bijdrages. Als jij het in je opsomming van argumenten wilt opnemen, kun je het daarheen kopiëren. Mvg, Trewal 10 nov 2018 18:15 (CET)

Knoop doorhakken[bewerken]

Ik weet niet hoe anderen erover denken, maar ik ga niet al die flauwekul van H. lezen en becommentariëren. Mijn voorstel: Laat degenen van de anderen die vindt dat de huidige tekst moet worden gewijzigd, dat hier melden. Als er niemand is, zijn we klaar en kan de tekst zo blijven als hij is. Als er nog iemand is die een wijziging - ik neem aan een kleine - wil voorstellen, dan kan daar naar gekeken worden. Madyno (overleg) 12 nov 2018 16:55 (CET)

Ik zie geen noodzaak tot wijzigen. Wat mij betreft kan de tekst zo blijven als hij is. Mvg, Trewal 12 nov 2018 17:06 (CET)
Niks mis met huidige situatie, beter zo laten. - Robotje (overleg) 12 nov 2018 20:29 (CET)
Ik vind de huidige tekst in orde. The Banner Overleg 12 nov 2018 22:37 (CET)
De huidige tekst vind ik geheel in orde, maar ik heb geen bezwaar tegen H.'s voorstel om onder de formule voor de volgende zin toe te voegen: "Het herhaald toepassen van deze recursie-formule laat zien dat elke term bepaald is door t1 en t2." Bob.v.R (overleg) 12 nov 2018 23:25 (CET)
Oke, Madyno (overleg) 13 nov 2018 00:30 (CET)

'Ik vind' ... 'ik vind' ... , versus argumentatie op inhoud[bewerken]

Naast het in bovenstaande bijdragen voorkomende meningen "Wat mij betreft" (Trewal), "Niks mis" (Robotje), "Ik vind" (The Banner), "vind ik" (Bob.v.R) en "Oke" (Madyno), zet ik nogmaals de zin Bovendien zou bij het volgen van de brede definitie niet langer de beste argumentatie de hoofdrol spelen in een discussie over de inhoud, maar de stem van een op een willekeurige overlegpagina aanwezige meerderheid. in een Arbcom-uitspraak van 24 juli 2018 22:30 (CEST).

Bij de laatste zin in deze bijdrage van Madyno:
Gekeken kan worden naar de in sectie 'De argumenten onder elkaar' vermelde varianten en argumentatie; inhoudelijke aanvullingen en/of weerleggingen kunnen daar toegevoegd. De beste argumentatie zal (conform de Arbcom) de artikeltekst dienen te bepalen.
Het tevreden zijn met, het in orde achten van, een artikeltekst betekent natuurlijk niet dat er in dat artikel geen verbeteringen mogelijk zijn. Toch? -- Hesselp (overleg) 13 nov 2018 20:10 (CET)

Ten eerste ben je nu weer selectief aan het citeren: Ook kan vastgesteld worden dat de bewerkingen van Hesselp geen vandalisme zijn in de enge zin zoals beschreven op Wikipedia:Vandalisme. Men zou het gedrag van Hesselp onder de brede zin kunnen scharen, maar dat is een hellend vlak. Bovendien zou bij het volgen van de brede definitie niet langer de beste argumentatie de hoofdrol spelen in een discussie over de inhoud, maar de stem van een op een willekeurige overlegpagina aanwezige meerderheid. is het volledige relevante citaat.
Ten tweede hebben wij het hier nu niet over vandalisme (waar het citaat over ging) maar over een medewerker die met zijn gedrag tal van andere medewerkers tot wanhoop drijft.
Muren van tekst, slecht leesbaar en talloze malen herhaald. Het maakt niet uit hoe jou verteld werd dat een bepaalde passage/verwoording niet gewenst was want korte tijd later kom je weer met exact hetzelfde voorstel.
Overleggen is toch echt wat anders dan eindeloos doorneuzelen tot de gesprekspartner van ellende een lantarenpaal wurgt!
Ik krijg niet de indruk dat jij jouw gesprekspartners serieus neemt. The Banner Overleg 13 nov 2018 20:32 (CET)
Hesselp veinst dat het hem gaat om de beste argumentatie, maar in werkelijkheid worden er door Hesselp vileine spelletjes gespeeld, vooral het spel van het uitputten, afmatten en eindeloos frustreren van de nog niet afgehaakte overige gebruikers. Daar is wikipedia niet bij gebaat, integendeel zelfs. Bob.v.R (overleg) 13 nov 2018 20:57 (CET)

Wat anderen schrijven zijn uiteraard geen argumenten, maar slechts wat zij vinden. Wat Hesselp schrijft zijn uiteraard argumenten, niet wat hij vindt... Ja, ja, echt waar, lieve kijkbuis kindertjes! Mvg, Trewal 13 nov 2018 21:37 (CET)

NOu, nou, ik vat (bijna) alles wat H. als 'argumentatie' opvoert niet als zinnige argumenten op. Madyno (overleg) 13 nov 2018 23:47 (CET)
Inderdaad, Trewal, met jouw "Ik zie geen noodzaak ..." en jouw "Wat mij betreft..." geef je aan wat jij vindt. En ook:
(Betreft overleg 'Zin 1':) Met de zin "Voor de beschrijving met een dummy-variabele (a, in variant A) zijn geen voordelen genoemd ten opzichte van de kortere variant D." wordt een feit genoemd; een feit dat als argument meetelt.
(Betreft overleg 'Eigenschap 1':) Bij variant C worden geen nadelen genoemd; het bij variant A genoemde Nadeel-1, en het bij variant B genoemde Nadeel-2 en Nadeel-3 zijn in variant C niet van toepassing; dit zijn feiten die meetellen als argument.
(Betreft overleg 'Eigenschap 2':) Het bij variant A genoemde Voordeel A-1 en Voordeel A-2 worden niet bestreden; dit feit telt mee als argument. -- Hesselp (overleg) 14 nov 2018 14:26 (CET)

Ik denk dat het bij variant A genoemde Nadeel-1, gecombineerd met het bij variant B genoemde Voordeel-4, in het niet valt bij het in en vorig leven bij Eigenschap 1, sub 3 genoemde Voordeel van 20% op het meer-duidleijk-zijn van de genoemde regel 5 volzin 2, 3e woord. Madyno (overleg) 14 nov 2018 14:56 (CET)

Prima, dan zijn we nu klaar. Bob.v.R (overleg) 14 nov 2018 20:13 (CET)
Inderdaad. The Banner Overleg 14 nov 2018 20:43 (CET)
Ik ben ook klaar, en wel met Hesselp. Dit is geen mening, maar een feit dat als argument meetelt. Daarvoor noem ik de volgende feiten, die als argument meetellen:
  1. Op 11 nov 2018 13:02 (CET) schrijft Hesselp "Trewal. Je meent dat [...] voor lezers onvoldoende duidelijk is. En dat [...] bij lezers onvoldoende bekend is." Dat Hesselp dit schrijft is geen mening, maar een feit dat als argument meetelt.
  2. Op 11 nov 2018 22:39 (CET) schrijf ik "Ik heb het daar niet over gehad, dus verzin aub geen meningen die ik niet heb geuit om ze vervolgens als feitelijk weer te geven, maar beperk je tot het onderwerp [...] Wat is immers "en zó voort", als je schrijft ? Dat is nog minder expliciet dan de ervoor staande visualisatie... Wat voegt deze nog minder expliciete uitleg volgens jou toe? Volgens mij niets. Als je het daar niet verder over wilt hebben, dan houdt voor mij de discussie op. Van vuil spel ben ik niet gediend." Dit is geen mening, maar een feit dat als argument meetelt.
  3. Op 12 nov 2018 15:43 (CET) schrijft Hesselp "Trewal. Jouw [...] heb ik verwoord als [...] Sorry, het kan aan mij liggen, maar ik zie ook nu nog niet dat jouw "men" in deze context naar wat anders kon verwijzen dan mijn verwoording 'voor/bij lezers'. Ook je toelichting maakt me geen verschil duidelijk." Niets in die bijdrage gaat over de vraag wat de genoemde nog minder expliciete uitleg volgens Hesselp toevoegt. Dit is geen mening, maar een feit dat als argument meetelt.
  4. Uit #2 ("beperk je tot het onderwerp" en "Als je het daar niet verder over wilt hebben, dan houdt voor mij de discussie op") en #3 ("niets in die bijdrage gaat over de vraag wat de genoemde nog minder expliciete uitleg volgens Hesselp toevoegt") kan geen andere conclusie volgen, dan dat voor mij de discussie met Hesselp ophoudt. Van vuil spel ben ik niet gediend. Dat is geen mening, maar een feit dat als argument meetelt.
Ik wens de Arbcom veel wijsheid, sterkte en succes met de behandeling van de zaak Hesselp. Mvg, Trewal 15 nov 2018 02:39 (CET)
Als ik duidelijk aangeef dat er niets mis is met de huidige situatie dan is het gewoon een feit dat ik dat zo vind. Voor vaststellen of er consensus is voor aanpassing heeft Hesselp gewoon dat feit te accepteren. - Robotje (overleg) 15 nov 2018 13:50 (CET)

H. drijft toch weer gewoon z'n (on)zin door.Madyno (overleg) 19 nov 2018 22:11 (CET)

En zo te zien kan "men" gewoon info in het artikel knallen, achteraf wat halfzachte bronnen op de overlegpagina gooien waarna "anderen" met redenen omkleed en geschraagd met bronnen en richtlijnen de onzin aan moeten vechten en daarbij de troep drie dagen laten staan. Ik had gebruiker:Josq toch moeten wraken voor deze zaak... The Banner Overleg 19 nov 2018 22:35 (CET)
Nee, dat kan Hesselp niet, want hij voldoet in het geheel niet aan maatregel 1, want hij geeft geen bronnen die alle inhoudelijke aspecten van de wijziging onderbouwen. Daarom ongedaan gemaakt. Uitgebreidere motivatie ergens hierboven, als reactie op zijn "motivatie". Mvg, Trewal 19 nov 2018 23:02 (CET)
Inderdaad, hierboven heb ik reeds beargumenteerd dat in de inleiding het gebruiken van een notatie met an voor méér lezers begrijpelijk zal zijn dan de door Hesselp doorgedramde notatie . Als Hesselp daarentegen serieus meent dat zijn notatie duidelijker is, dan zal hij dat met bronnen aan moeten tonen. Bob.v.R (overleg) 20 nov 2018 03:44 (CET)
Kanttekening bij Bob.v.R's: "hierboven heb ik reeds beargumenteerd ...".
Bij het aanvankelijke "de rij met algemene term " is door Bob.v.R hier als voordeel genoemd: "Duidelijkheid (a.u.b. geen vervolgvragen van Hesselp)".
En hier stelde hij: "De door Hesselp voorgestelde formulering is evident minder duidelijk dan de huidige tekst, want minder lezers zullen begrijpen wat ermee bedoeld wordt."
In geen van beide commentaren wordt vergeleken met de door mij geplaatste variant: "de rij ".
Verder is het invoegen van het woordje 'evident' als onderbouwing bij 'minder duidelijk', niet te zien als zakelijk argument. Blijft de vraag: wat zou er voor lezers duidelijker kunnen zijn aan die dummy-formulering? -- Hesselp (overleg) 20 nov 2018 17:32 (CET)
Ik zie geen bronnen. Bob.v.R (overleg) 20 nov 2018 20:36 (CET)
@Bob.v.R. Voor de korte formulevorm in zin 1 zijn hier (inmiddels 2) bronnen vermeld. Blijft de vraag: wat zou er voor lezers duidelijker kunnen zijn aan die dummy-formulering in de onderhavige situatie? -- Hesselp (overleg) 20 nov 2018 23:18 (CET)
Bij de notaties en wordt de lezer een puzzel voorgeschoteld, waaruit de lezer al of niet kan opmaken wat er nu in feite wordt bedoeld. Bij de formulering met is de bedoeling direct duidelijk. Mocht Hesselp van mening zijn dat de Hesselp-notatie duidelijker is dan de formulering met , dan zal Hesselp die Hesselp-pov met bronnen moeten zien te onderbouwen. Tot nu toe heb ik een dergelijke onderbouwing niet gezien. Bob.v.R (overleg) 21 nov 2018 00:03 (CET)
Ik stelde tweemaal eerder: "Blijft de vraag: wat zou er voor lezers duidelijker kunnen zijn aan die dummy-formulering in de onderhavige situatie?". Die vraag wordt door Bob.v.R niet beantwoord. Want: waarom zou de kortere vorm zónder dummy a, een puzzel zijn, en de langere vorm mét dummy a direct duidelijk? Ik stel dus de vraag ten derde male.
In het leerboek Inleiding in de analyse (B.Kaper, H. Norde, 1996) komt de dummyloze notatie vele tientallen keren voor. Tegen nergens de dummynotatie wanneer daar niet een speciale praktische reden voor is. Zo'n praktische reden is bij de beginzin van 'Harmonische rij' niet aan te wijzen. Kan Bob.v.R bronnen met tegenvoorbeelden tonen? -- Hesselp (overleg) 21 nov 2018 00:56 (CET)

Extreem kort artikel[bewerken]

De eerste zin op deze discussiepagina is van H. en begint zo: "Bij dit extreem korte artikel toch een vraag." H. moet gedacht hebben: "dan maar een extreem lange discussie." Madyno (overleg) 20 nov 2018 21:26 (CET)

Ter bestrijding van chaos een vertaling van de voorstellen van Hesselp[bewerken]

Voorstel 1: Eerste zin[bewerken]

Bestaande tekst
,

dus de rij met algemene term .

Voorgestelde tekst
,   dus de rij .
  • Argumentatie:
  1. Er zijn geen nadelen genoemd voor het vervangen van   " met algemene term "  door   ""
  2. Voor de wat langere en complexere variant met de dummy-variabele a zijn geen voordelen genoemd.
  • Bronnen voor de kortere vorm:
  1. WolframMathWorld
  2. B. Kaper, H. Norde, Inleiding in de analyse, 1996, p.181 "De rij convergeert naar 0, maar is niet sommeerbaar".
Commentaar indiener/aanvullingen
  • ...
Commentaar derden
  • Geen van beide bronnen zoals hier gepresenteerd dekt de voorgestelde wijzigingen. Conform de ArbCom-uitspraak is deze actie dus niet toegestaan. The Banner Overleg 21 nov 2018 00:58 (CET)

Voorstel 2: sectie 'Meer algemeen', vijfde zin[bewerken]

Bestaande tekst

Want aangezien het verschil tussen de omgekeerden van twee opvolgende termen constant is, volgt voor een drietal :

,

waaruit volgt dat iedere term als volgt is vastgelegd door de twee voorgaande termen:

Voorgestelde tekst

Want uit het constant zijn van het verschil tussen de omgekeerden van twee opvolgende termen, volgt voor een drietal :

en daaruit .
  • Argumentatie
  1. Eigenschap 1 (subsectie 'Meer algemeen', vijfde zin) Bij de nu geplaatste variant zijn geen nadelen genoemd. Als minpunten bij de vervangen zin zijn te zien: (1) het eerste 'volgt' is taalkundig fout bij het voorafgaande 'aangezien' (bij 'volgt' past een 'uit ...'); (2) het dubbele 'volgt' in "waaruit volgt dat iedere term als volgt is vastgelegd ..." maakt dat zinsgedeelte lastig leesbaar; (3) de lengte van de zin; (4) 'omdat' is gewoner dan 'aangezien'.
  • Bronnen
  1. "Korte, makkelijk begrijpbare zinnen hebben de voorkeur." (Arbcom-uitspraak, sectie 'Inhoud, structuur en vorm').
  2. J. Renkema, Schrijfwijzer, sectie: Leesgemak / Eenvoud / Lange zinnen.
Commentaar indiener/aanvullingen
  • ...
Commentaar derden
  • Natuurlijk kan de ArbCom-uitspraak niet als bron gelden. The Banner Overleg 21 nov 2018 01:08 (CET)
  • De oude tekst is inhoudelijk oké, maar er staat wel erg vaak 'volgt' in. Kan aangepast worden. Madyno (overleg) 21 nov 2018 12:30 (CET)
  • De aanhaling van de bronnen suggereert dat het een feit is dat de voorgestelde wijziging de tekst makkelijker leesbaar maakt. Dat is in mijn lezing bepaald niet het geval. Bij wiskundige onderwerpen kan wat context en iets meer bewoordingen juist de leesbaarheid bevorderen voor leken. Maar om eerlijk te zijn zie ik niet waarom zo extravagant veel energie moet worden besteed aan deze voorgestelde wijziging. Het is allemaal cosmetisch. Effeietsanders 26 nov 2018 00:02 (CET)
@Effeietsanders. Je opmerking lijkt gebaseerd op bovenstaande twee weergaven van 'Voorstel 2'. The Banner heeft zich daar echter vergist in de scheiding tussen 'Voorstel 2' en 'Voorstel 3'. De teksten waar het echt om gaat staan hier en hier. Of direct onder elkaar hier. Vervalt hiermee je kritische opmerking bij mijn 'makkelijker leesbaar' ?
Bij je 'extravagant veel energie'. Iemand die niet op de hoogte is van de voorgeschiedenis van de artikelen 'Harmonische rij' en van 'Reeks (wiskunde)' zal inderdaad makkelijk de indruk kunnen krijgen dat het hier om betrekkelijk kleine (vrij kleine, nogal kleine, erg kleine) dingen gaat. Het belang van het kunnen doorvoeren van deze beperkte wijzigingen heeft direct te maken met de eerste zin ná de intro, met De bij de harmonische rij behorende reeks ... . In discussies rond de interpretatie van die zeven woorden is het maximaal helder en scherp kiezen van formuleringen en notaties van zeer groot belang. Wat is de bedoeling van de dubbelepunt in die eerste zin? Hoort de formule ná die dubbelepunt ook nog bij de bedoelde naam? En zie in datzelfde kader mijn recente bewerkingspoging van het Reeks-artikel 3 nov 2018 21:45‎. -- Hesselp (overleg) 26 nov 2018 13:52 (CET)
Ik heb jouw gevraagd hoe de tekst dan wel moest zijn maar daar weigerde jij antwoord op te geven. Nu moet jij niet jouw weigering tot medewerking gaan gebruiken als argument tegen het commentaar van effeietsanders. The Banner Overleg 26 nov 2018 14:18 (CET)
Voor de goede orde, ik heb The Banner op zijn vergissing gewezen met de volgende zin:
"Bij het maken van de scheiding tussen Voorstel 2 en Voorstel 3 heb je je vergist. Voorstel 3 gaat over het harmonisch gemiddelde, en begint dus bij de zin waarin 'harmonisch gemiddelde' genoemd wordt. Wat daarvóór staat hoort bij Voorstel 2. Zowel bij 'Bestaande tekst' als bij 'Voorgestelde tekst'. -- Hesselp (overleg) 21 nov 2018 23:34 (CET)"
Het heeft meerdere dagen geduurd voordat ik bij toeval ontdekte dat 'harmonisch gemiddelde' ook in de inleiding voorkomt. -- Hesselp (overleg) 26 nov 2018 15:18 (CET)
Tja, blijkbaar kom je dus met allerlei wijzigingen terwijl je gefaald hebt het artikel ordentelijk te lezen. The Banner Overleg 26 nov 2018 16:17 (CET)
Ook na je toelichting vind ik het niet vanzelfsprekend dat de versie die Hesselp ondersteunt beter leesbaar is dan die wordt ondersteund door The Banner. Als ik moet kiezen, vind ik de laatste beter leesbaar. Dus als dat de aanname is, gaat dat argument dus niet op wat mij betreft. Dat is het punt dat ik probeer te maken. Effeietsanders 27 nov 2018 06:45 (CET)
@Effeietsanders. Voor alle duidelijkheid, want erg concreet ben je nog steeds niet met alleen een verwijzing naar "de door ... ondersteunde versie", mijn vraag of inderdaad jouw voorkeur - qua betere leesbaarheid - uitgaat naar de 'Want aangezien ...'-zin boven het alternatief met de 'Want uit ...'-zin gevolgd door de 'De laatste formule ...'-zin. En dat je dus kiest voor een zin:
- met een lengte van 31 woorden (boven een splitsing in 21 + 13 woorden);
- beginnend met twee voegwoorden, waardoor de zinsstructuur complexer is dan in het alternatief;
- met de (m.i.) geen correct Nederlands zijnde "aangezien [...], volgt voor een drietal [...]"  (wél correct lijkt me "aangezien [...], geldt [...]", dan wel "uit [...] volgt [...]");
- met het (niet echt fout, maar m.i. onnodig lastig leesbaar zijnde) dubbele 'volgt' in "waaruit volgt dat iedere term als volgt is vastgelegd ..." ;
- met een drievoudig 'volgt' in één zin (waar ook Madyno dit minder wenselijk noemde);
- met de onnodige indices-wisseling van (n-1, n, n+1) in de eerste formule naar (n-2, n-1, n) in de tweede.
Bij een 'ja' op bovenstaande vraag zie ik graag een onderbouwing van je keuze, mede in relatie tot het genoemde zestal aspecten. -- Hesselp (overleg) 27 nov 2018 12:27 (CET)
Ik sluit me aan bij Effeietsanders; de versie die Hesselp ondersteunt lijkt me niet beter leesbaar. Geen reden dus voor aanpassen van het artikel op de manier die Hesselp voorstaat. - Robotje (overleg) 27 nov 2018 13:08 (CET)
@Robotje. Het aansluiten bij Effeietsanders betekent: "vind ik de laatste [de door The Banner ondersteunde versie] beter leesbaar". Dat is niet hetzelfde als "de versie die Hesselp ondersteunt lijkt me niet beter leesbaar". Welke van beide bedoel je? (In BTNI-situaties kan het bijvoorbeeld verschil maken.) Verder ook aan jou de vraag om onderbouwing van je keuze, mede in relatie met het hier genoemde zestal aspecten. -- Hesselp (overleg) 27 nov 2018 13:52 (CET)
Ik heb aangeven "... de versie die Hesselp ondersteunt lijkt me niet beter leesbaar." Effeietsanders geeft aan dat als hij moet kiezen hij die van jou minder leesbaar vindt. Jij kan vinden dat ik me daarbij niet aansluit bij wat Effeietsanders schreef in die edit (dus niet alleen die ene zin, maar ook de context). Prima, dan denk je dat maar. Of iets beter leesbaar overkomt is persoonlijk. We kunnen ook wel gaan discussieren of het beter/mooier is om een schutting rood, blauw of geel te verven, wat de ene beter/mooier vindt is gewoon een persoonlijke inschatting. Korter kan beter zijn voor de leesbaarheid, maar is dat niet altijd zo. Als ik het heb over 'dat lijkt mij' dan maak ik daarmee duidelijk dat dat mijn inschatting is, en dat ik ook kan respecteren dat een ander daar anders over denkt. Ik hoop dat jij intussen ook kan respecteren dat ik, en blijkbaar ook andere wikipedianen in deze discussie, jouw voorstellen niet beter leesbaar vinden. Al meerdere collega's hebben aangegeven dat volgens hen jouw voorstel het niet beter leesbaar maakt. Jou stelling dat je versie het beter leesbaar wordt dus zeker niet algemeen gedeeld. Ik wil best aannemen dat je je voorstel nog steeds een beter leesbare vesie vindt. Kun jij accepteren dat jouw visie niet door iedereen gedeeld wordt? - Robotje (overleg) 27 nov 2018 14:40 (CET)
@Robotje. Mijn vraag "Welk van beide bedoel je?" zie ik in je reactie niet beantwoord. Is het 'niet beter' of is het 'minder'?
Bij jouw "(dus niet alleen die ene zin, maar ook de context)". In deze edit van Effeietsanders leek mij (en lijkt mij) zijn "wat context en iets meer bewoordingen" moeilijk anders te interpreteren dan alleen betrekking hebbend op die ene (lange) 'Want aangezien...'-zin. Daardoor blijft me onduidelijk waar je op doelt met "maar ook de context".
Bij je slotvraag aan mij met 'jouw visie'. Ik kan niks met 'visies' die zich uiten in een kort generaliserend 'voor' of 'tegen' een tekstversie als geheel. Wat ik je kan antwoorden is dat ik geen reden zie om te accepteren dat anderen door mij opgesomde argumenten, aspect voor aspect, voor elk van de drie conflictzinnen apart, geheel (een enkele keer 'bijna geheel') negeren. Zich onttrekken aan een inhoudelijke bespreking punt voor punt. Op mijn gedetailleerde (meen ik) motivatie van mijn voorkeursversie onder het kopje 'Vergelijking van twee versies ...' is tot nu toe uitsluitend niet-inhoudelijk commentaar gevolgd (The Banner, Trewal, Bob.v.R). Het gaat bij elk van de drie zinnen inhoudelijk om iets heel anders; het gaat dus niet om het al dan niet beter leesbaar zijn van een versie in z'n geheel. Het gaat om 'de hoofdrol voor de beste argumentatie', zegt ook de Arbcom. -- Hesselp (overleg) 27 nov 2018 21:08 (CET)
Aha, daar kom je de arbcom-zaak over jouw blokkade weer even misbruiken. En sorry, Hesselp, dat ging over vandalisme. Weet je nog: Ook kan vastgesteld worden dat de bewerkingen van Hesselp geen vandalisme zijn in de enge zin zoals beschreven op Wikipedia:Vandalisme. Men zou het gedrag van Hesselp onder de brede zin kunnen scharen, maar dat is een hellend vlak. Bovendien zou bij het volgen van de brede definitie niet langer de beste argumentatie de hoofdrol spelen in een discussie over de inhoud, maar de stem van een op een willekeurige overlegpagina aanwezige meerderheid. Heeft dus niets te maken met jouw huidige dwarsliggerij. The Banner Overleg 28 nov 2018 23:36 (CET)
Voor wat betreft voorstel 1, 2 en 3 van Hesselp zie ik geen verbetering van de leesbaarheid. Dat varieert van slechter leesbaar tot op z'n best net aan gelijkwaardig in leesbaarheid. In geen van de gevallen dus reden voor vervanging. Gewoon houden zo. - Robotje (overleg) 4 dec 2018 08:51 (CET)
Robotje, je geeft hierboven expliciet aan dat je je oordeel baseert op door The Banner hier, 20, 21 november verminkt weergegeven tekstversies. Ook zonder die vergissingen zou het tekstversies en variant-suggesties betreffen die geen van alle meer actueel zijn. Dat schiet niet op. Bij eventueel nog komend commentaar graag precies verwijzen naar de beoordeelde varianten. -- Hesselp (overleg) 4 dec 2018 10:20 (CET)
Jij hebt vlakweg geweigerd aan te geven waar ik de mist ben in gegaan zodat ik het had kunnen repareren. En dus moet je nu niet gaan miemelen over het feit dat Robotje reageerde op een fout die ik door jouw gebrek aan medewerking niet kon corrigeren. Probeer eens helder taalgebruik toe te passen. The Banner Overleg 4 dec 2018 11:00 (CET)
"Vlakweg geweigerd"?? Voor eventuele nieuwe lezers nog maar eens mijn melding aan The Banner van 21 nov 2018 22:35 geciteerd:
Bij het maken van de scheiding tussen Voorstel 2 en Voorstel 3 heb je je vergist. Voorstel 3 gaat over het harmonisch gemiddelde, en begint dus bij de zin waarin 'harmonisch gemiddelde' genoemd wordt. Wat daarvóór staat hoort bij Voorstel 2. Zowel bij 'Bestaande tekst' als bij 'Voorgestelde tekst'.
Voor wie is dat onvoldoende helder? -- Hesselp (overleg) 4 dec 2018 12:22 (CET)
Inderdaad: zie hier: Overleg gebruiker:The Banner#Harmonische rij. Misschien andere kopjes in het discussie-schema?. Blijkbaar is helder taalgebruik en een helder vorm simpelweg niet aan jou besteed. Want over alles en werkelijk alles ben jij moeilijk aan het doen. Hetzij met regelrechte obstructie, hetzij met onleesbare teksten, hetzij met editwarren. The Banner Overleg 4 dec 2018 12:44 (CET)
@Hesselp, Bij alle drie de voorstellen is het veld 'Commentaar indiener' ook nu nog steeds leeg gebleven. Het zijn jouw voorstellen dus was het niet meer dan logisch als je daar had aangegeven dat ze niet correct weergegeven of ingetrokken zijn. Ik reageer op je vraag "Welk van beide bedoel je?" en als ik daar dan op rageer krijg ik stank voor dank. Als jij denkt dat de voorstellen niet meer actueel zijn, dan geef je dat voortaan maar beter aan. Op deze manier is overleggen met je wel heel erg lastig aan het worden. - Robotje (overleg) 4 dec 2018 12:56 (CET)

Voorstel 3: sectie 'Meer algemeen', op twee na laatste zin[bewerken]

Bestaande tekst

Door het herhaald toepassen van deze recursie-formule is te zien dat elke term bepaald is door en .

Tevens is te zien dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren:

Voorgestelde tekst

De laatste formule zegt dat iedere term is vastgelegd door de twee voorafgaande. Het herhaald toepassen van deze recursie-formule laat zien dat elke term bepaald is door en .

Voor elke harmonische rij geldt dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren, in formule:

.
  • Argumentatie
  1. Eigenschap 2 (subsectie 'Meer algemeen', op twee na laatste zin) De voordelen van de nu geplaatste variant A als genoemd in de sectie 'De argumenten onder elkaar', zijn daar niet bestreden. Tegen het aangevoerde "Duidelijk blijkt waarom het woord 'gemiddelde' gebruikt wordt." pleit het juist zeer óngebruikelijk zijn van impliciete vormen als     en     ter weergave in formulevorm van een rekenkundig dan wel een meetkundig gemiddelde.
  • Bronnen
  1. Harmonic mean
Commentaar indiener/aanvullingen
  • ...
Commentaar derden
  • De vorm in de oude tekst laat precies zien wat een harmonisch gemiddelde is, zoals ook in het lemma in Wikipedia genoemd wordt. Madyno (overleg) 21 nov 2018 12:25 (CET)
    Eens, ik vind ook de bestaande tekst eleganter omdat het laat zien waar de berekening vandaan komt) Daarnaast geeft de aangehaalde bron eigenlijk beide versies (de andere versie staat met wat omhaal beschreven in de zin na de formule). De argumentatie overtuigt me niet, en de bron dus ook niet. Effeietsanders 28 nov 2018 20:15 (CET)
@Effeietsanders. Ik kan niet goed raden waar je in je eerste zin naar verwijst met 'de bestaande tekst'. (Want heel misschien vergis je je weer in welke tekst bij welke eigenschap hoort? Hierboven staat het nog steeds verkeerd.) En bedoel je met 'tekst' alleen het deel in woorden, of de hele zin inclusief de formule?
Evenmin begrijp ik naar welke berekening je verwijst met 'de berekening'.
En ten slotte: bedoel je met je "De argumentatie" het zestal punten (1-6) zoals ik die hier toonde? (Er staan daar twee bronnen, jij hebt het over de bron.) -- Hesselp (overleg) 29 nov 2018 00:45 (CET)

Vergelijking van twee versies; argumenten en bronnen; alternatieve formuleringen[bewerken]

Hieronder volgt, verdeeld in secties Zin 1, Eigenschap 1, Eigenschap 2, de actualisering van argumentatie en bronnen bij [ deze artikelversie 25 nov 2018 19:57] deze artikelversie 25 nov 2018 19:57. Tevens zijn eerder voorgestelde alternatieve formuleringen vermeld.

Zin 1[bewerken]

Voorkeursversie Hesselp

In de wiskunde wordt met harmonische rij in engere zin de volgende rij aangeduid:

,   dus de rij .

Voorkeursversie anderen

In de wiskunde wordt met harmonische rij in engere zin de volgende rij aangeduid:

,

dus de rij met algemene term .

Argumentatie en bronnen bij 'Voorkeursversie Hesselp'
1. De vorm geeft een korte, volledig complete aanvullende beschrijving van de al in opsommingsvorm (inclusief 'algemene term') getoonde harmonische rij. De wat langere 'Voorkeursversie anderen', met a als 'dummy-variabele', voegt geen enkele informatie toe en is evenmin makkelijker leesbaar. Die notatievorm is pas zinvol voor rijen die veel overzichtelijker, of zelfs uitsluitend, te beschrijven zijn met gevals-onderscheiding of met een recursie-formule (in plaats van met een 'algemene term'). Er dienen in de beginzin (waarin al een link voorkomt naar 'Rij (wiskunde)') geen zaken aan de orde te komen die niet het specifieke onderwerp betreffen.
2. Bron: B. Kaper, H. Norde, Inleiding in de analyse, 1996, p.181 "De rij convergeert naar 0, maar is niet sommeerbaar". Op zeker honderd plaatsen komt een rij-beschrijving in formulevorm voor, een klein aantal daarvan in de tweestaps 'dummy-notatie' met uit de context volgende redenen.
3. Bron: WolframMathWorld Het lemma 'Sequence' noemt het symbool de meest gebruikelijke notatie (hier voor de rij der even getallen).

Eerdere alternatieve formuleringen
6 nov 2018 10:01‎
In de wiskunde wordt met harmonische rij in engere zin de volgende rij aangeduid:

8 nov 2018 10:11‎
In de wiskunde wordt met harmonische rij in engere zin de volgende rij aangeduid:

,

dus de rij met algemene term .

10 nov 2018 11:52 (overlegpagina)
In de wiskunde wordt met harmonische rij in engere zin de volgende rij aangeduid:

,

dus de rij met algemene term .

11 nov 2018 19:05 (overlegpagina)
In de wiskunde wordt met harmonische rij in engere zin de volgende rij aangeduid:

,

waarmee bedoeld is de rij .

Bij Zanaqs wijzigingen in Zin 1
Het weghalen van "in engere zin" uit regel 1 lijkt me een verbetering.
Met het vervangen van 'wordt aangeduid met' door 'is', wordt echter een eerdere bewuste wijziging helaas weer ongedaan gemaakt, zie deze bewerking door Madyno. Juist ook in de rij/reeks-context dienen bewoordingen (en notaties) zo eenduidig mogelijk te zijn. De sectie 'Meer algemeen' begint met opzet met "De benaming ... ".
En eveneens helaas laat Zanaq de overbodige extra rij-beschrijving met een dummy-variabele (nu tn ipv. an) staan. Die is nodig bij door recursie of gevalsonderscheiding bepaalde rijen, maar niet hier in de eerste zin. Zanaq leek er hier al voor gekozen te hebben, maar draaide het terug. En nog dit: als ik het weer zou weghalen, is er géén sprake van 'ongedaanmaking van bewerkingen van andere gebruikers' , zie hier (Zeg maar: 'voortschrijdend inzicht'.)
Rekening houdend met Zanaqs voorkeur voor "X is een Y" lijken me nu - bijvoorbeeld - de volgende varianten in aanmerking te komen (kleine breukjes kan ook, eerste term in breukvorm kan ook):
(Variant F)
De harmonische rij is in de wiskunde de naam van de oneindige rij
met algemene term .
(Variant G)
De harmonische rij is in de wiskunde de naam van de oneindige rij
.
-- Hesselp (overleg) 28 nov 2018 15:44 (CET)

Eigenschap 1[bewerken]

Voorkeursversie Hesselp

Een harmonische rij is, net als een rekenkundige en een meetkundige, helemaal bepaald door de eerste twee termen. Want uit het constant zijn van het verschil tussen de omgekeerden van twee opvolgende termen, volgt voor een drietal :

en daaruit .

De laatste formule zegt dat iedere term is vastgelegd door de twee voorafgaande. Het herhaald toepassen van deze recursie-formule laat zien dat elke term bepaald is door en .

Voorkeursversie anderen

Een harmonische rij is, net als een rekenkundige en een meetkundige, helemaal bepaald door de eerste twee termen.

Want aangezien het verschil tussen de omgekeerden van twee opvolgende termen constant is, volgt voor een drietal :

,

waaruit volgt dat iedere term als volgt is vastgelegd door de twee voorgaande termen:

Door het herhaald toepassen van deze recursie-formule is te zien dat elke term bepaald is door en .

Argumenten en bronnen bij 'Voorkeursversie Hesselp'
1. In 'Voorkeursversie anderen' is de combinatie van 'aangezien' en 'volgt' (in: "aangezien [...], volgt voor een drietal [...]") qua woordkeus m.i. fout. Een correcte combinatie is hier ofwel "aangezien [...], geldt [...]", ofwel "uit [...] volgt [...]".
2. In 'Voorkeursversie anderen' is het dubbele 'volgt' in "waaruit volgt dat iedere term als volgt is vastgelegd ..." niet echt fout, maar maakt dat zinsgedeelte lastig leesbaar.
3. In 'Voorkeursversie anderen' begint de tweede zin met twee voegwoorden ('Want aangezien') waardoor de zin onnodig lastig leesbaar is.
4. Het drievoudige 'volgt' in één zin hoeft niet logisch fout te zijn, maar stilistisch, en dus voor de leesbaarheid, is het minder wenselijk. Hetzelfde geldt voor de vrij grote lengte van die zin.
5. Bron: "Korte, makkelijk begrijpbare zinnen hebben de voorkeur." (Arbcom-uitspraak, sectie 'Inhoud, structuur en vorm').
6. Bron: J. Renkema, Schrijfwijzer, sectie: Leesgemak / Eenvoud / Lange zinnen (3e druk, p. 15).
7. Er is geen reden om niet in beide formules hetzelfde drietal indices te gebruiken. De wisseling van (n-1, n, n+1) naar (n-2, n-1, n) zal voor sommige lezers hinderlijk zijn.

Eerdere alternatieve formuleringen
25 okt 2018 17:27‎
Een harmonische rij is, net als een rekenkundige en een meetkundige rij, helemaal bepaald door z'n eerste twee termen:

28 okt 2018 22:01‎
Een harmonische rij is, net als een rekenkundige en een meetkundige rij, helemaal bepaald door de eerste twee termen:

30 okt 2018 08:16‎
Een harmonische rij is, net als een rekenkundige en een meetkundige rij, helemaal bepaald door de eerste twee termen: wat gelijkwaardig is met het meer regelmatige

30 okt 2018 23:22‎
Een harmonische rij is, net als een rekenkundige en een meetkundige rij, helemaal bepaald door de eerste twee termen. Want uit het gelijk zijn van de afstanden tussen de omgekeerden van drie opeenvolgende termen ofwel volgt

2 nov 2018 22:22‎
Een harmonische rij is, net als een rekenkundige en een meetkundige, helemaal bepaald door de eerste twee termen. Want uit het constant blijven van het verschil tussen de omgekeerden van opvolgende termen, volgt voor een drietal :

en daaruit .
Bij Madyno's wijzigingen in Eigenschap 1
Het weghalen van twee van de drie keer 'volgt' in één zin, lijkt me zeker een verbetering.
Helaas(1) is ook het 'verklaring-aankondigende' verbindingswoord 'Want' weggehaald.
Helaas(2) is niet gekozen voor "uit (het constant zijn van.....), volgt (...de gelijkheid ...)" maar voor "omdat (...constant is), volgt (...de gelijkheid ...)". Wat even krom en incorrect Nederlands is als het vergelijkbare "wegens (het constant zijn van.....), volgt (...de gelijkheid ...)". (De combinatie "omdat ..., geldt" lijkt me wél correct.)
Helaas(3) heeft Madyno's gebruik van indices tot gevolg dat voor "ieder term" in de eropvolgende formule "tn+1" staat, en twee zinnen later voor "elke term": "tn". Onlogisch, ook al wegens het terugverwijzende "Tevens". Waarom kies je niet voor n-2, n-1, n als indices? -- Hesselp (overleg) 28 nov 2018 15:44 (CET)
De eerste zin geeft een formule voor het bepalen van een volgende term op basis van twee reeds bekende termen. Dit maakt de keuze voor index n+1 voor deze volgende term logisch en duidelijk. De tweede zin geeft een formule voor de relatie van een term met zijn beide buren. Dit maakt de keuze voor index n tussen buur n-1 en buur n+1 logisch en duidelijk. Ditzelfde geldt ook bij de beschrijving aan de hand van het verschil van omgekeerden van twee termen: ook hier is het logisch en duidelijk om het verschil met omgekeerde voorgaande term gelijk te stellen aan het verschil met omgekeerde volgende term. Ook dat pleit voor de keuze van indices n-1, n, n+1. Mvg, Trewal 28 nov 2018 16:59 (CET)
Trewal, je bent vaak sterk in het bedenken van spitsvondige, op het eerste gezicht aannemelijk lijkende, redeneringen. Maar dat wil nog niet zeggen dat die redeneringen niet te weerleggen zijn.
Bij je zin 1+2. De 'Omdat'-zin in het artikel spreekt van "iedere term [vastgelegd door] twee voorafgaande termen". Bij dat iedere past het beste index n, en bij het twee voorafgaande index n-1 (1e voorafgaande) en index n-2 (2e voorafgaande). Jouw "volgende" komt niet voor in de 'Omdat'-zin, en samen met 'voorafgaande' zou het lijken alsof er nog een term tussenin hoort, quod non.
Bij je zin 3+4. Helemaal akkoord: onderbuur n-1 en bovenbuur n+1.
Bij je zin 5+6. Je 'logisch en duidelijk' krijgt geen onderbouwing. Want (terzijde: hetzelfde 'want' zou niet misstaan als begin van de 'Omdat'-zin) de beschrijving in formulevorm van het constant zijn van verschillen, verlangt alleen drie opvolgende indices. Een goede reden om n in het midden te kiezen (zoals wél bij de harmonisch-gemiddelde-eigenschap) zie ik hier niet. Het meest logisch zou zijn het drietal n, n+1, n+2, maar dan kom je uit bij het iets minder wenselijke tn+2=... ipv. tn=... . Zoals al gezegd: n-2, n-1, n - mijn voorkeur - past naadloos bij de tekst. -- Hesselp (overleg) 28 nov 2018 19:47 (CET)
Het meest logisch is om voor het drietal termen, aan de hand waarvan meerdere eigenschappen worden beschreven, steeds dezelfde drie indices te gebruiken. Wordt de middelste in relatie tot zijn buren besproken, dan heeft n in het midden de uitgesproken voorkeur. Het meest logisch is dus n-1, n, n+1. Mvg, Trewal 28 nov 2018 20:11 (CET)
Trewal, hoe hebben we het nou? Jij wilt in de 'Omdat'-zin indices gebruiken die niet (of in ieder geval: slechter dan nodig) passen bij het ieder en het twee voorafgaande in dezelfde zin(?) Terwille van een nergens goed voor zijnde, hoogstens 'cosmetisch' te noemen parallel met het indexgebruik bij een andere (los van de vorige staande) eigenschap in een andere zin(?) Dat noem jij 'het meest logisch' (ondersteund door suggestieve maar hier misplaatste termen als 'meerdere' en 'steeds')? Heb je daar medestanders voor? Ja: vragen, vragen, vragen ... . -- Hesselp (overleg) 28 nov 2018 22:19 (CET)
Ik denk dat er wel medestanders zijn voor mijn voorkeur voor indices n-1, n, n+1. Ik ben namelijk niet degene die die voorkeur in het artikel heeft geplaatst. Zijn er medestanders voor jouw voorkeur? Mvg, Trewal 28 nov 2018 22:27 (CET)
De genoemde eigenschappen volgen overigens beide uit het feit dat het verschil tussen een omgekeerde term en zijn omgekeerde linkerbuur gelijk is aan het verschil tussen diezelfde omgekeerde term en zijn omgekeerde rechterbuur. Ik zou die eigenschappen daarom zeker niet (suggestief) losstaand willen noemen. Er staat dan ook niet voor niets "Tevens is te zien dat [...]". Mvg, Trewal 28 nov 2018 22:43 (CET)
"Beide eigenschappen volgen uit dezelfde verschillen-gelijkheid." Ja, dat haalt je de koekoek. Die verschillengelijkheid definieert het harmonisch zijn van een rij, en beide eigenschappen betreffen juist de harmonische rijen. (Om dat extra te benadrukken had ik er eerst het kopje 'Eigenschappen' boven gedacht, het leek me later overbodig.) Dat maakt die twee eigenschappen dus niets meer of minder 'losstaand' dan elk ander koppel eigenschappen van harmonische rijen. Een flink verschil is, dat eig.1 ook voor heel veel andere rijen geldt, en eig.2 juist niet (als ik me niet vergis). Dus toch maar n-2, n-1, n in de 'Omdat'-zin? -- Hesselp (overleg) 28 nov 2018 23:28 (CET)
Nee, want bij deze rij zijn de eigenschappen helemaal niet losstaand. Ze worden in dit kopje beide afgeleid uit de verschillengelijkheid. Die afleiding geeft niet slechts de ene eigenschap, maar diezelfde afleiding geeft tevens de andere eigenschap. En daar wil ik het verder bij laten, want een herhaling van zetten heeft weinig zin. Mvg, Trewal 28 nov 2018 23:35 (CET)
Trewal, ik zie helaas niet waar je met jouw "deze rij" naar verwijst. En uit de verschillengelijkheid wordt de eerste keer de hoogste term 'vrijgemaakt', de tweede keer (al dan niet het omgekeerde van) de middelste. Wat nou dezelfde afleiding? -- Hesselp (overleg) 29 nov 2018 00:06 (CET)
Hesselp, jij had het in je voorgaande bijdrage over "heel veel andere rijen". Ik heb het in reactie daarop over deze rij, en bedoel daarmee uiteraard de harmonische rij in het algemeen, want dat is waar dit artikelhoofdstuk over gaat. Is dat nou zo moeilijk te begrijpen? De drie formuleringen (verschillengelijkheid; volgende term bepaald door zijn 2 voorgangers; harmonisch gemiddelde van buren) geven allemaal in feite dezelfde relatie tussen de drie termen. Door deze ene relatie op twee manieren te herschrijven (door het naar voren halen van een specifiek deel), worden de twee eigenschappen toegelicht. Is dat nou zo moeilijk te begrijpen? PS. dit zijn retorische vragen, waar ik géén antwoord op hoef te hebben, en mocht er toch nog een reactie komen, dan zal ik daar niet meer op antwoorden. Ik ben je pingpongspelletje zat. Mijn visie is je bekend. Daar zul je het mee moeten doen. Mvg, Trewal 29 nov 2018 01:36 (CET)
Trewal (en anderen), dit allemaal tot je dienst (jammer van de onduidelijkheid mbt. "deze rij", "de harmonische rij", "de harmonische rij in het algemeen" en het bedoelde "harmonische rijen").
Bij jouw "... worden de twee eigenschappen toegelicht":
In de toelichtende formule voor de tweede eigenschap kies je, terecht, de indices n en n-1, n+1 voor elke term en beide buren. Maar bij de voorafgaande eerste eigenschap is de toelichtende formule onnodig verwarrend, omdat je hetzelfde drietal: n+1 en n, n-1, nu gebruikt voor iedere term en de twee voorgaande (in plaats van het logische(r) n en n-1, n-2).
Je maakt niet waar dat het cosmetische 'allebei hetzelfde drietal indices' voor een lezer belangrijker is dan het verschoven zijn van de indices in de eerste situatie. In plaats daarvan kom je met het verwijt 'pingpongspelletje'. Dat beide totaal verschillende (en dus 'losstaand' te noemen) eigenschappen beide uit de definitie van 'harmonische rij' volgen, is - nogmaals - noodzakelijk en dus vanzelfsprekend.
Indachtig het "overweeg alternatieve formuleringen" (ArbCom-uitspraak, Advies 1.) suggereer ik - bijvoorbeeld - nog de volgende varianten voor de hier bediscussieerde passage uit de artikeltekst:
(Langere variant; twee verschillende indices-tripels:)
Want uit het constant zijn van het verschil tussen de omgekeerden van twee opvolgende termen, volgt voor een drietal :
en daaruit .
De laatste formule zegt dat iedere term is vastgelegd door de twee voorafgaande. Het herhaald toepassen van deze recursie-formule laat zien dat elke term bepaald is door en .
Voor iedere harmonische rij geldt dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren. Want het gelijk zijn van de verschillen tussen de omgekeerden van leidt tot: [formulevorm].
(Kortere variant; bij de tweede eigenschap géén formulevorm en dus geen indices, alleen de korte tekstzin:)
In elke harmonische rij is iedere term (vanaf de tweede) het harmonisch gemiddelde van zijn beide buren.
-- Hesselp (overleg) 29 nov 2018 15:28 (CET)
Waar zijn de bronnen die aantonen dat deze werkwijze gangbaar is in de Nederlandstalige wiskundige wereld? The Banner Overleg 29 nov 2018 16:04 (CET)

Eigenschap 2[bewerken]

Voorkeursversie Hesselp

Voor elke harmonische rij geldt dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren, in formule:

.

Voorkeursversie anderen

Tevens is te zien dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren:

Argumenten en bronnen bij 'Voorkeursversie Hesselp'
1. Het beginnen met "Voor elke harmonische rij" wijst er nog even op dat het niet alleen gaat om een eigenschap van DE harmonische rij.
2. De formule past rechtstreeks ('expliciet') bij het "elke term ... is" uit de formulering in woorden.
3. Het rechterlid is precies de weergave in formulevorm van 'harmonisch gemiddelde van tn-1 en tn+1'.
4. Voor het in formulevorm aanduiden van het rekenkundig gemiddelde en het meetkundig gemiddelde zijn de niet-expliciete formules     en   erg ongebruikelijk.
5. Bron: De Encyclopedia of Mathematics geeft in het lemma Harmonic mean uitsluitend de expliciete formulevorm.
6. Bron: De Wikipedia-pagina Harmonisch gemiddelde geeft na de definitie in woorden eerst de expliciete formulevorm , gevolgd door: "Deze formule wordt vaak geschreven als ".

Eerdere alternatieve formuleringen
1 nov 2018 20:08‎
Voor elke harmonische rij geldt dat elke term (vanaf de tweede) het harmonisch gemiddelde is van beide buren.
-- Hesselp (overleg) 25 nov 2018 20:59 (CET)


Tja, de ArbCom is natuurlijk geen bron. En Wikipedia is ook geen bron voor Wikipedia. Dat had je inmiddels kunnen weten. Dit is nu geloof ik de vierde keer dat je met dit verhaal komt... The Banner Overleg 25 nov 2018 22:18 (CET)
Zie daarom hier. Mvg, Trewal 26 nov 2018 00:24 (CET)
In de Hesselp-zin "De wat langere 'Voorkeursversie anderen', met a als 'dummy-variabele', voegt geen enkele informatie toe en is evenmin makkelijker leesbaar." wordt in 1 zin een door Hesselp niet gewenste notatie in een negatieve framing gepositioneerd (middels de tendentieuze term 'dummy-variabele') en wordt aangaande de leesbaarheid de Hesselp-pov als feit opgevoerd. Nee Hesselp, zo werkt het natuurlijk niet. Het is een opinie, het is jouw opinie, en er is geen consensus over deze Hesselp-opinie. Bob.v.R (overleg) 26 nov 2018 01:30 (CET)
Bij Bob.v.R's "in een negatieve framing gepositioneerd". De term 'dummy-variabele' bestaat - bij mijn weten - alleen in wiskundetaal. Van enige relatie met 'dom' is daar totaal geen sprake; het 'dummy' verwijst daar naar een andere betekenis van dat woord. Goed, niet iedereen is voldoende thuis in wiskundetaal; het vervangen van 'dummy-variabele' door bijvoorbeeld 'lokale variabele' zou echter voor wiskundig geschoolden weer wat minder pregnant zijn. Ik verzoek aan lezers van deze regels daarom het door mij eerder gebruikte 'dummy-variabele' overal te lezen als "dummy-variabele (lokale variabele)". En ik zal voortaan in vergelijkbare situaties die laatste aanduiding gebruiken.
Mag ik aannemen, Bob.v.R, dat hiermee je bezwaren tegen deze artikelversie en de bijbehorende motivatie op deze overlegpagina ondervangen zijn? -- Hesselp (overleg) 26 nov 2018 16:02 (CET)
Heb jij bronnen voor jouw beweringen, Hesselp? The Banner Overleg 26 nov 2018 16:19 (CET)
Op mijn vragen "Zijn er bronnen die de algemene term in de algemene notatie van een rij een 'dummy-variabele' noemen? Of is dit slechts een door Hesselp bedachte denigrerende aanduiding van het begrip 'algemene term'?" kwam nog geen bevredigend antwoord. Mvg, Trewal 26 nov 2018 17:27 (CET)
@Trewal. Ik gebruikte de term 'dummy-variabele' in de mij bekende betekenis, zoals ik die nu ook aantref bij Wolfram MathWorld: "... only as a placeholder and which disappears completely in the final result". Ik meen nog steeds dat die beschrijving past bij de bedoelde beschrijvingswijze van een rij. De betreffende harmonische rij hangt niet af van de variabele a (this placeholde disappears completely in the final result); overigens evenmin van n, en dus ook niet van het met een variabele geïndiceerde symbool an ter aangeduiding van een 'algemene term'.
Ook zonder dat ik een plaats aanwijs waar 'dummy-variabele' direct bij de rij-notatie expliciet genoemd staat, meen ik dat het gebruik van die term zoals ik deed, geheel legitiem is. Bij vrij uitvoerig zoeken op internet zag ik de term nog nergens gebruikt in denigrerende zin. Jij wel? Waar? -- Hesselp (overleg) 26 nov 2018 18:16 (CET)
Maar is die Engelstalige term ook gangbaar in de Nederlandstalige wiskundige wereld? The Banner Overleg 26 nov 2018 18:27 (CET)
Nee, ik zag de term 'dummy-variabele' bij uitvoerig zoeken ook nergens gebruikt worden ter aanduiding van de 'algemene term' van een rij. Vandaar ook mijn eerste vraag hierboven. Als jij dat ook niet kunt vinden, dan hoeven we het dus niet meer over 'dummy-variabele' te hebben, maar kunnen we gewoon van 'algemene term' van een rij spreken en de harmonische rij beschrijven aan de hand van de algemene term . Mvg, Trewal 26 nov 2018 19:08 (CET)
Uitsluitend de persoon met de dummy-gebruikersnaam Hesselp gebruikt de term 'dummy-variabele', kennelijk omdat inhoudelijke argumenten ontbreken. Verder merk ik op dat Hesselp met de zin "Mag ik aannemen, Bob.v.R, ...." bewust aan het provoceren is. Bob.v.R (overleg) 27 nov 2018 07:08 (CET)
@Trewal. Het beschrijven van de harmonische rij aan de hand van z'n 'algemene term' kan ook uitstekend zónder gebruikmaking van een - ter beschrijving van recursief bepaalde rijen noodzakelijke - dummy-variabele (zoals: an). Bijvoorbeeld als volgt, na regel 1:
met algemene term.
-- Hesselp (overleg) 27 nov 2018 13:19 (CET)
@Bob.v.R. Bij "bewust aan het provoceren is". Ja, dat was ik daar bewust, voorzover dat 'provoceren' gelezen wordt als: het uitdagen om te laten blijken welke concreet aangewezen bezwaren er bij hem eventueel nog leven tegen de genoemde artikelversie. -- Hesselp (overleg) 27 nov 2018 13:19 (CET)
In plaats van provoceren en verhaaltjes vertellen kan je ook bewijzen to0nen van Nederlandstalige bronnen die het hebben over "dummy-variabele". Tot nu toe heb je nog niet aangetoond met bronnen dat die kreet gangbaar is in het Nederlandstalige wiskundig taalgebied. The Banner Overleg 29 nov 2018 15:58 (CET) En dus kan de wijziging gewoon niet doorgevoerd worden.

Vragen[bewerken]

Vragen ,vragen, vragen. Kinderen die ... Madyno (overleg) 28 nov 2018 16:24 (CET)

Bij bewerking 7 dec 2018 19:40 door Hesselp[bewerken]

Toelichting bij een aantal aanvullingen en omwerkingen in deze artikeltekst.

  • Een veel logischer volgorde en indeling is bereikt door het vooropzetten van de algemene harmonische rij. Ook alle genoemde 'eigenschappen' betreffen die algemene rij. Hieronder staan er bronnen voor genoemd.
  • De 'aanverwanten' van de algemene harmonische rij (alternerend, hyperharmonisch, reeks) zijn daardoor naar achter geschoven.
  • Over de beginzin. Met Zanaqs voorkeur voor een standaardvorm voor de start van een lemma, kan ik wel meegaan. Het lijkt me dat die standaardvorm wel herkenbaar blijft, als er ter wille van een vlot lopende (en een zo eenduidig mogelijk te interpreteren) zin niet letterlijk "X is een Y" staat, maar een variant als "X is de naam voor ....", of omgekeerd: "Een ... heet X". Ook als het 'nieuwe' woord niet een substantief is, zal de zinsvorm zich moeten aanpassen. Alleen het korte 'IS' kan andere, onbedoelde, interpretaties toelaten als het wat langere 'IS DE NAAM VOOR'. Of een constructie met 'HEET' of 'WORDT GENOEMD'. Het 'IS' past in de formulering van een stelling, terwijl het hier om een definitie gaat.
  • Het "in de wiskunde" in de beginzin mag er van mij uit. Enerzijds wordt de naam ook in de muziekleer gebruikt, en anderzijds is er de suggestie in te lezen dat de bedoelde rijen buiten de wiskunde een andere naam hebben.
  • Voor het duidelijk maken van het bepaald zijn van de hele rij door alleen de eerste twee termen ('Eigenschap 1'), kwam ik op een rechtstreekse doorzichtige formule voor tn bij gegeven t1, t2 en n. Jammer van alle detail-discussies over de verklaring via recursie.
  • Onder het hoofdje 'Harmonisch gemiddelde' zijn wat mij betreft beide formules overbodig, ze zijn direct te vinden onder de link in de tekstzin. Het toevoegen van een poging tot een nader 'bewijs(je)' lijkt me een onnodige zijstap.
  • Mijn opvatting over de vaagheid van de aanduiding 'reeks' zal bij een aantal van de huidige volgers hier bekend zijn. De zin is blijven staan; ik overweeg nog er een toelichting bij te plaatsen. (Iets in de geest van: Over de betekenis van 'reeks' (ofwel 'formele som') in de analyse, bestaat geen duidelijkheid (niet meer dan: 'een abstract wiskundig object') . In de abstracte algebra is wel een betekenis van 'formele som' vastgelegd.)

Bronnen voor het voorop plaatsen van de algemene harmonische rij:
- https://www.britannica.com/science/harmonic-sequence-mathematics];
- Van Dale, Groot woordenboek der Nederlandse taal, onder 'harmonisch';
- Jan Versluys, Leerboek der rekenkunde, "Een rij van getallen, waarvan elke drie opeenvolgende gedurig harmonisch evenredig zijn, noemt men een harmonische reeks" ('reeks' en 'getallenrij' zijn hier synoniem) [13];
- P. Wijdenes, Lagere Algebra II, 8e druk 1965, p.281: "de omgekeerden van de termen van een rekenkundige rij vormen een harmonische rij" (met als voorbeeld: tk = 10 / (3k−8) );
- Bij de met 'harmonische rij' vergelijkbare onderwerpen 'rekenkundige rij' en 'meetkundige rij' wordt altijd begonnen met het algemene geval, nooit met het meest speciale.

Bronnen voor het in formulevorm beschrijven van het 'harmonisch gemiddelde' :
Een derde bron voor de expliciete vorm (tn = ...) is: H. von Mangoldt, K. Knopp, Einführung in die höhere Mathematik Deel 1, 2e druk 1958, p.130.
De in het Wikipedia-lemma Harmonisch gemiddelde genoemde impliciete variant wordt in dat lemma niet door bronnen gesteund. Zijn er elders bronnen voor te vinden?

Bij bezwaren tegen onderdelen van de nu geplaatste versie, verwacht ik dat het bepaalde in Maatregel-1 en Maatregel-2 van de ArbCom-uitspraak gevolgd zal worden.
Verder meen ik dat in de huidige versie op geen enkel onderdeel een bewerking (als bedoeld in Maatregel-3) van een andere gebruiker ongedaan gemaakt is (dan wel gedeeltelijk ongedaan gemaakt is). Naar mijn opvatting (mede gezien de hier gemaakte opmerking over 'algemeen Wikipediataalgebruik') zijn een herschrijving, een vereenvoudiging, een andere verwoording, een herformulering in verband met een toevoeging, een herschikking van onderdelen (zoals deze vookomen in de nu geplaatste versie), geen ongedaanmakingen als door de ArbCom aan mij ontzegd.
Wanneer een andere gebruiker, of een moderator, in de nu geplaatste versie wel 'ongedaanmakingen als bedoeld in Maatregel-3' aanwezig acht, verwacht ik dat die op deze pagina stuk voor stuk gespecificeerd worden aangewezen. Zodat overleg erover en eventueel aanpassing van de artikeltekst, mogelijk blijft.
Bij terugdraaiing op de artikelpagina zonder dat voldaan is aan het genoemde in Maatregel-1 en Maatregel-2, zal ik die terugdraaiing ongedaan maken vanwege strijdigheid met die ArbCom-maatregelen. -- Hesselp (overleg) 7 dec 2018 19:40 (CET)

Maatregel 3: Hesselp zal bewerkingen van andere gebruikers niet ongedaanmaken, ook niet gedeeltelijk. Dit is dus de zoveelste overtreding. The Banner Overleg 7 dec 2018 19:55 (CET)
De ArbCom had er erg veel eenvoudiger aan gedaan mijn heldere verzoek van juni 2018 over te nemen: het door Hesselp zelf niet meer laten bewerken van artikelpagina's. Dat de ArbCom een meer genuanceerde route heeft gekozen, wordt nu door Hesselp misbruikt middels verder getrol, gezeur, gemillimeter, gezever, geklier, geprovoceer en niet te vergeten het nog verder verzieken van de werksfeer. Bob.v.R (overleg) 7 dec 2018 22:52 (CET)

X is een y[bewerken]

Artikelen beginnen met een variant op X is een y. Daar hoeven we geen 72 uur op te wachten, en ook geen bronnen voor te leveren, en zeker niet door enorme overlegteksten te hoeven ploegen. — Zanaq (?) 7 dec 2018 19:42 (CET)

Daarbij weet Hesselp heel goed dat hij geen edits van anderen ongedaan mag maken conform Maatregel 3 van de ArbCom uitspraak: Hesselp zal bewerkingen van andere gebruikers niet ongedaanmaken, ook niet gedeeltelijk. Hij trekt zich duidelijk niets aan van de uitspraak. The Banner Overleg 7 dec 2018 19:53 (CET)